Align catechol 1,2-dioxygenase (EC 1.13.11.1) (characterized)
to candidate RR42_RS23505 RR42_RS23505 catechol 1,2-dioxygenase
Query= BRENDA::Q9F103 (306 letters) >FitnessBrowser__Cup4G11:RR42_RS23505 Length = 304 Score = 402 bits (1032), Expect = e-117 Identities = 198/306 (64%), Positives = 234/306 (76%), Gaps = 2/306 (0%) Query: 1 MNRQQIDALVKQMNVDTAKGPVDERIQQVVVRLLGDLFQAIEDLDIQPSEVWKGLEYLTD 60 M +I+ALVK +DTA G D R+Q VVVRL DLF+AIEDLD+ SEVWKG+EY + Sbjct: 1 MTHPEIEALVKAFILDTASGKADARVQSVVVRLTTDLFKAIEDLDLSASEVWKGIEYFAE 60 Query: 61 AGQANELGLLAAGLGLEHYLDLRADEADAKAGITGGTPRTIEGPLYVAGAPESVGFARMD 120 AG ELGLLAAGLGLE +LD+RADEA+AKAG+ GGTPRTIEGPLYVAGAP S GFAR+D Sbjct: 61 AGP--ELGLLAAGLGLERFLDIRADEAEAKAGLAGGTPRTIEGPLYVAGAPASEGFARLD 118 Query: 121 DGSESDKVDTLIIEGTVTDTEGNIIEGAKVEVWHANSLGNYSFFDKSQSDFNLRRTILTD 180 DGSE + + L ++GTV DT G + GA VEVWHAN LGNYSFFDK+QSDFNLRRTI TD Sbjct: 119 DGSEDGQGEVLFMQGTVFDTSGKPLPGASVEVWHANLLGNYSFFDKTQSDFNLRRTITTD 178 Query: 181 VNGKYVALTTMPVGYGCPPEGTTQALLNKLGRHGNRPSHVHYFVSAPGYRKLTTQFNIEG 240 G+Y + +P+GYGCPP+GTTQ LL+ LGRHG RP+H+H+FVSAPG+RKLTTQ NI+G Sbjct: 179 SEGRYQFRSIVPMGYGCPPQGTTQRLLDLLGRHGRRPAHIHFFVSAPGHRKLTTQINIDG 238 Query: 241 DEYLWDDFAFATRDGLVATATDVTDEAEIARRELDKPFKHITFNVELVKEAEAAPSSEVE 300 DEYLWDDFAFA+R+GLV V +A LDKPF I F+ L + AAP EVE Sbjct: 239 DEYLWDDFAFASREGLVPALRHVESPRALAEHGLDKPFASIDFDFRLYADCAAAPVPEVE 298 Query: 301 RRRASA 306 R RA+A Sbjct: 299 RTRAAA 304 Lambda K H 0.315 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 304 Length adjustment: 27 Effective length of query: 279 Effective length of database: 277 Effective search space: 77283 Effective search space used: 77283 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS23505 RR42_RS23505 (catechol 1,2-dioxygenase)
to HMM TIGR02439 (catA: catechol 1,2-dioxygenase (EC 1.13.11.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02439.hmm # target sequence database: /tmp/gapView.24516.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02439 [M=285] Accession: TIGR02439 Description: catechol_proteo: catechol 1,2-dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-136 440.3 0.0 1.3e-136 440.1 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS23505 RR42_RS23505 catechol 1,2-dioxyg Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS23505 RR42_RS23505 catechol 1,2-dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 440.1 0.0 1.3e-136 1.3e-136 3 285 .] 4 285 .. 2 285 .. 0.98 Alignments for each domain: == domain 1 score: 440.1 bits; conditional E-value: 1.3e-136 TIGR02439 3 kevqallkkvagleqeg.gnarikqivlrvlsdlfkaiedlditedefwaaveylnklGqanelgllaa 70 +e++al+k+ ++++g ++ar++ +v+r+ +dlfkaiedld++++e+w+++ey++++G elgllaa lcl|FitnessBrowser__Cup4G11:RR42_RS23505 4 PEIEALVKAFILDTASGkADARVQSVVVRLTTDLFKAIEDLDLSASEVWKGIEYFAEAGP--ELGLLAA 70 699*****99887777669***************************************95..8****** PP TIGR02439 71 GlGlehfldlrldaadakagleggtPrtieGPlyvaGapvseGfarlddgseddkaetlvlkGqvldae 139 GlGle+fld+r+d+a+akagl ggtPrtieGPlyvaGap seGfarlddgsed ++e+l+++G+v+d+ lcl|FitnessBrowser__Cup4G11:RR42_RS23505 71 GLGLERFLDIRADEAEAKAGLAGGTPRTIEGPLYVAGAPASEGFARLDDGSEDGQGEVLFMQGTVFDTS 139 ********************************************************************* PP TIGR02439 140 GkpiagakvevwhanskGnysffdksqsefnlrrtiitdaeGkyrarsvvPvGygvppqgptqqllnll 208 Gkp++ga vevwhan Gnysffdk+qs+fnlrrti+td+eG+y++rs+vP+Gyg+ppqg+tq+ll+ll lcl|FitnessBrowser__Cup4G11:RR42_RS23505 140 GKPLPGASVEVWHANLLGNYSFFDKTQSDFNLRRTITTDSEGRYQFRSIVPMGYGCPPQGTTQRLLDLL 208 ********************************************************************* PP TIGR02439 209 GrhGerPahvhffvsapgyrklttqinlegdkylyddfafatreglvaevkevedaaaakrrgvegrfa 277 GrhG+rPah+hffvsapg+rklttqin++gd+yl+ddfafa+reglv+++++ve a +++g++++fa lcl|FitnessBrowser__Cup4G11:RR42_RS23505 209 GRHGRRPAHIHFFVSAPGHRKLTTQINIDGDEYLWDDFAFASREGLVPALRHVESPRALAEHGLDKPFA 277 ********************************************************************* PP TIGR02439 278 eiefdlel 285 +i+fd++l lcl|FitnessBrowser__Cup4G11:RR42_RS23505 278 SIDFDFRL 285 *****987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (304 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.82 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory