Align Catechol 1,2-dioxygenase (EC 1.13.11.1) (characterized)
to candidate RR42_RS34685 RR42_RS34685 catechol 1,2-dioxygenase
Query= reanno::WCS417:GFF4624 (309 letters) >FitnessBrowser__Cup4G11:RR42_RS34685 Length = 288 Score = 166 bits (421), Expect = 5e-46 Identities = 100/275 (36%), Positives = 144/275 (52%), Gaps = 13/275 (4%) Query: 22 LNDGGNPRTKALVYRILRDTVNIIEDLEVTPEEFWKAVNYLNELGK-----HQEAGLLAA 76 + D +PR + +V ++ + + + EEF + ++ LG + E L A Sbjct: 9 MRDTTDPRLREVVEALVDHLHAFLRQVRPSDEEFEAGLRFVAALGHATHATNNEVVLAAD 68 Query: 77 GLGLEHYLDLLMDAADEKAGKSGG-TPRTIEGPLYVAGAPLSKYEARLDDGKDDAVPLFM 135 LGL + L+ + G +GG TP + GP Y GAP + G+ +PLF+ Sbjct: 69 VLGLSTLVTLMNN------GITGGRTPGALLGPFYRGGAPSYACGDCVVQGETPGLPLFV 122 Query: 136 RGQVRDTEGKPLAGAIVDVWQANTAGTYSWFDPTQSEFNLRRRIETDAQGNYRFRSIVPS 195 RGQVR+T G+PLAGA+V+ WQA+ G Y DP+Q + NLR DAQG + FRS+ P+ Sbjct: 123 RGQVRNTAGEPLAGALVEAWQASPVGLYDNQDPSQPDKNLRGAFRADAQGRFHFRSVRPA 182 Query: 196 GYGCPPSGPTQQLLDQLGRHGQRPAHIHFFISAPGHRHLTTQINLSDDPYLHDDFAYATR 255 GY P GP QLL + RH RPAHIHF +APG+R L TQ+ D +L D + Sbjct: 183 GYPVPTGGPVGQLLAEQNRHPYRPAHIHFIAAAPGYRTLVTQVFADDSEHLESDVTFGVH 242 Query: 256 DELIAQIRFSDDPQLAREFGVEGRFAQIDFDFELQ 290 EL+ R D+ + G F +DF+F L+ Sbjct: 243 RELVGHFRRVDE-GTSPWGGFPAPFYTLDFNFVLE 276 Lambda K H 0.318 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 288 Length adjustment: 27 Effective length of query: 282 Effective length of database: 261 Effective search space: 73602 Effective search space used: 73602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory