Align Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 (characterized)
to candidate RR42_RS15380 RR42_RS15380 kynurenine formamidase
Query= SwissProt::P0C8P4 (218 letters) >FitnessBrowser__Cup4G11:RR42_RS15380 Length = 221 Score = 341 bits (874), Expect = 7e-99 Identities = 163/207 (78%), Positives = 176/207 (85%) Query: 11 RRIWDISPAVSPATPVWPGDTPFQHDPAWQLDEHCPVNVGRITMSPHTGAHADAPLHYAA 70 R++WDISPA+SP TPVWPGDTPFQ + WQ+D HCPVNVGRIT+SPHTGAHADAPLHYAA Sbjct: 14 RQLWDISPALSPDTPVWPGDTPFQLERNWQIDAHCPVNVGRITLSPHTGAHADAPLHYAA 73 Query: 71 DGAPIGAVPLDAYLGPCRVIHCIGAAPRVEPQHIAHALAGTPPRVLLRTYAQAPQGKWDS 130 DGAPIG V L YLGPCRVIHCIG AP VEP+HI HALAG PPRVLLRTY QAP KWD Sbjct: 74 DGAPIGEVDLAHYLGPCRVIHCIGVAPLVEPRHIGHALAGAPPRVLLRTYQQAPLAKWDP 133 Query: 131 AFCAVAPETISLLARHGVRLIGIDTPSLDPETSKTMDAHHAVRDHQLAILEGIVLDEVPA 190 FCAVAPETI+LLA HGV L+GIDTPSLDP+ SKTM AH+ VR H+LAILEG+VLD V Sbjct: 134 DFCAVAPETIALLAEHGVMLVGIDTPSLDPQESKTMAAHNMVRRHRLAILEGLVLDAVAE 193 Query: 191 GDYELIALPLRLATLDASPVRAVLREL 217 DYELIALPLR A LDASPVRAVLR L Sbjct: 194 ADYELIALPLRFAGLDASPVRAVLRSL 220 Lambda K H 0.320 0.137 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 221 Length adjustment: 22 Effective length of query: 196 Effective length of database: 199 Effective search space: 39004 Effective search space used: 39004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate RR42_RS15380 RR42_RS15380 (kynurenine formamidase)
to HMM TIGR03035 (kynB: arylformamidase (EC 3.5.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03035.hmm # target sequence database: /tmp/gapView.10685.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03035 [M=206] Accession: TIGR03035 Description: trp_arylform: arylformamidase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-103 330.4 0.0 3e-103 330.2 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS15380 RR42_RS15380 kynurenine formamid Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS15380 RR42_RS15380 kynurenine formamidase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 330.2 0.0 3e-103 3e-103 2 206 .] 16 220 .. 15 220 .. 0.99 Alignments for each domain: == domain 1 score: 330.2 bits; conditional E-value: 3e-103 TIGR03035 2 lidisqplnedlatwPGdtpfsqelavsleeegsvnvgritlsvhtGahvdaPlhykndgakigdveld 70 l+dis++l++d+++wPGdtpf+ e++++++++++vnvgritls+htGah+daPlhy +dga+ig+v+l lcl|FitnessBrowser__Cup4G11:RR42_RS15380 16 LWDISPALSPDTPVWPGDTPFQLERNWQIDAHCPVNVGRITLSPHTGAHADAPLHYAADGAPIGEVDLA 84 8******************************************************************** PP TIGR03035 71 vylGpcrvidclsalekiekealksaleeapervllrtaekakaeafdediaavapdtiellaekGvrl 139 ylGpcrvi+c+++++++e++++ +al++ap+rvllrt+++a+ ++d d++avap+ti+llae+Gv l lcl|FitnessBrowser__Cup4G11:RR42_RS15380 85 HYLGPCRVIHCIGVAPLVEPRHIGHALAGAPPRVLLRTYQQAPLAKWDPDFCAVAPETIALLAEHGVML 153 ********************************************************************* PP TIGR03035 140 iGvdtpsvdPleskeldahhalakhdlailenlvldevaeGdyelialPlklaeldaspvravlral 206 +G+dtps+dP+esk+++ah+ +++h+laile+lvld vae dyelialPl++a ldaspvravlr+l lcl|FitnessBrowser__Cup4G11:RR42_RS15380 154 VGIDTPSLDPQESKTMAAHNMVRRHRLAILEGLVLDAVAEADYELIALPLRFAGLDASPVRAVLRSL 220 *****************************************************************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (206 nodes) Target sequences: 1 (221 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 5.65 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory