Align 2-keto-4-pentenoate hydratase; 2-hydroxypentadienoic acid hydratase; EC 4.2.1.80 (characterized)
to candidate RR42_RS27885 RR42_RS27885 2-keto-4-pentenoate hydratase
Query= SwissProt::Q9S156 (260 letters) >FitnessBrowser__Cup4G11:RR42_RS27885 Length = 258 Score = 342 bits (878), Expect = 4e-99 Identities = 177/252 (70%), Positives = 206/252 (81%), Gaps = 2/252 (0%) Query: 9 AWAERLRHAEATATPIAPLREEITDNDSA--YAVQLVNVQYAQSQGRRIVGRKIGLTSLA 66 A A RLR AE T TP+ PLR EI D+A YA+Q NV ++QGRR+ GRKIGLTS A Sbjct: 4 ALARRLREAEQTRTPVEPLRGEIPPGDAAMAYAIQRANVDAWRAQGRRVAGRKIGLTSPA 63 Query: 67 VQKQLGVDQPDFGTLFADMLYGDDEAVPLSRTLQPKVEAEVALVLAKDLERPDTTLVDVI 126 VQ+QLGVDQPDFGTLFADM++GDDE +P++RTLQPK EAEVALVL +D+ + D TLVD+I Sbjct: 64 VQRQLGVDQPDFGTLFADMVFGDDEPIPVARTLQPKAEAEVALVLCRDVPQKDATLVDLI 123 Query: 127 SATAYVLPAIEIVGSRIADWNIRFIDTVADNASSGLVVLGAVPTALNALDLKLCQMQMTR 186 +A AYVLPAIE+VGSRI +W+I ++DTVADNASSGLVVLGAVP L LDLK +M+M R Sbjct: 124 NAVAYVLPAIEVVGSRIRNWDISYVDTVADNASSGLVVLGAVPVPLAGLDLKTVKMEMLR 183 Query: 187 NGDVVSTGSGGACLGHPLNAAVWLARRLANLGQPLRAGDLVLTGALGPMVAVNAGDRFEA 246 + + VSTGSG CLGHPLNAAVWLAR+LA LG PLRAGDL+LTGALGPMVAV G FEA Sbjct: 184 DDERVSTGSGADCLGHPLNAAVWLARKLAALGDPLRAGDLILTGALGPMVAVAPGQCFEA 243 Query: 247 RISGIGSVCAQF 258 RISGIGSV A+F Sbjct: 244 RISGIGSVRARF 255 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 258 Length adjustment: 24 Effective length of query: 236 Effective length of database: 234 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory