Align 2-oxopent-4-enoate hydratase subunit (EC 4.2.1.80) (characterized)
to candidate RR42_RS32640 RR42_RS32640 4-oxalocrotonate decarboxylase
Query= metacyc::MONOMER-3403 (222 letters) >FitnessBrowser__Cup4G11:RR42_RS32640 Length = 262 Score = 158 bits (400), Expect = 8e-44 Identities = 89/213 (41%), Positives = 127/213 (59%), Gaps = 1/213 (0%) Query: 8 ELGDELYQAMVQRETVTPLTSRGFDISVEDAYHISLRMLERRLAAGERVIGKKIGVTSKA 67 +L + L A + RE V +T ++ EDAY I + R+ A G R+ G K+G+TS A Sbjct: 10 QLAEHLETAELNREPVRKITDTHPEMDWEDAYAIQDAIRARKQARGTRIAGLKMGLTSFA 69 Query: 68 VQNMLGVHQPDFGYLTDAMVYNSGEAMPISEKLIQPRAEGEIAFILKKDLMGPGVTNADV 127 +GV P +G+LTD G A+ + LI P+ E EIAF+LK L GPG DV Sbjct: 70 KMRQMGVTDPVYGFLTDYGACMDGGAIDTAS-LIHPKVEAEIAFVLKHPLKGPGCHIGDV 128 Query: 128 LAATECVIPCFEVVDSRIQDWKIKIQDTVADNASCGLFVLGDQAVSPRQVDLVTCGMLVE 187 LAAT+ V+P EV+DSR ++++ ++ +ADN S FV+G S +DL G+++E Sbjct: 129 LAATDFVLPAVEVIDSRYENFRFDLKSVIADNTSSARFVVGGTHRSAEGIDLKNLGVVLE 188 Query: 188 KNGQLLSTGAGAAALGSPVNCVAWLANTLGHFG 220 KNG++++T AGAA LG P + VA LAN LG G Sbjct: 189 KNGEVVATAAGAAVLGHPASSVAMLANMLGARG 221 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 262 Length adjustment: 23 Effective length of query: 199 Effective length of database: 239 Effective search space: 47561 Effective search space used: 47561 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory