Align 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39) (characterized)
to candidate RR42_RS05095 RR42_RS05095 4-hyroxy-2-oxovalerate aldolase
Query= metacyc::MONOMER-11384 (352 letters) >FitnessBrowser__Cup4G11:RR42_RS05095 Length = 335 Score = 545 bits (1403), Expect = e-160 Identities = 269/334 (80%), Positives = 300/334 (89%) Query: 4 QKLYISDVTLRDGSHAIRHQYTVEQVKQIARALDDAKVDSIEVAHGDGLQGGSFNYGFGA 63 +K+++SDVTLRDG HAIRHQY++ Q IARALD A+VDSIEVAHGDGL G SFNYGFGA Sbjct: 2 KKVHVSDVTLRDGMHAIRHQYSLPQAVAIARALDAARVDSIEVAHGDGLNGSSFNYGFGA 61 Query: 64 HTDLEWIEAAASVVKHAKIATLLLPGIGTVHDLKAVYEAGVRVVRVATHCTEADISRQHI 123 HTDLEWI A A+ +KHA++ATLLLPGIGT+HDL+A Y+AG R VRVATHCTEADISRQHI Sbjct: 62 HTDLEWIAAVAAQLKHARVATLLLPGIGTIHDLRAAYDAGARTVRVATHCTEADISRQHI 121 Query: 124 EYARHLGMEAVGFLMMSHMTTPQHLAQQAKLMESYGATVCYVVDSGGALSMNDVRDRFRA 183 EYAR LGM+ VGFLMMSHMTTP LAQQA+LMESYGA YVVDSGGALSM DV +RF A Sbjct: 122 EYARKLGMDTVGFLMMSHMTTPAALAQQARLMESYGAQCVYVVDSGGALSMRDVAERFDA 181 Query: 184 FKDVLKPETQTGMHAHHNLSLGVANSIVAVENGCDRVDASLAGMGAGAGNAPLEVFIAAA 243 FK VL P T+TGMHAHHNLSLGVANS+VA+E+GCDRVDASLAGMGAGAGNAPLEVFIAA Sbjct: 182 FKQVLDPATETGMHAHHNLSLGVANSMVALEHGCDRVDASLAGMGAGAGNAPLEVFIAAI 241 Query: 244 ERMGWNHGTDLYKLMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEMAASKYG 303 +R G HGTDL+ LMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRH+E A+++YG Sbjct: 242 DRAGIAHGTDLHALMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHAEAASARYG 301 Query: 304 LKTVDILVELGRRRMVGGQEDMIIDVALDLLKQQ 337 + TVDILVELGRRRMVGGQEDMI+DVALDLL+Q+ Sbjct: 302 IATVDILVELGRRRMVGGQEDMIVDVALDLLRQR 335 Lambda K H 0.319 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 335 Length adjustment: 29 Effective length of query: 323 Effective length of database: 306 Effective search space: 98838 Effective search space used: 98838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate RR42_RS05095 RR42_RS05095 (4-hyroxy-2-oxovalerate aldolase)
to HMM TIGR03217 (dmpG: 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03217.hmm # target sequence database: /tmp/gapView.21950.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03217 [M=334] Accession: TIGR03217 Description: 4OH_2_O_val_ald: 4-hydroxy-2-oxovalerate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-179 581.4 12.2 3.1e-179 581.3 12.2 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS05095 RR42_RS05095 4-hyroxy-2-oxovaler Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS05095 RR42_RS05095 4-hyroxy-2-oxovalerate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 581.3 12.2 3.1e-179 3.1e-179 1 334 [] 2 335 .] 2 335 .] 0.99 Alignments for each domain: == domain 1 score: 581.3 bits; conditional E-value: 3.1e-179 TIGR03217 1 kkltitdvtLrdGshavrhqftaeevraiaaaLdeagvdaievahGdGLggsslnyGfsaasdleliea 69 kk++++dvtLrdG+ha+rhq++ +++aia+aLd+a+vd+ievahGdGL+gss+nyGf+a++dle+i+a lcl|FitnessBrowser__Cup4G11:RR42_RS05095 2 KKVHVSDVTLRDGMHAIRHQYSLPQAVAIARALDAARVDSIEVAHGDGLNGSSFNYGFGAHTDLEWIAA 70 689****************************************************************** PP TIGR03217 70 aaeavkkakvavlllPGigtveelkaaadaGvkvvrvathcteadvseqhielarelgletvgfLmmsh 138 +a ++k+a+va+lllPGigt+++l+aa+daG+++vrvathctead+s+qhie+ar+lg++tvgfLmmsh lcl|FitnessBrowser__Cup4G11:RR42_RS05095 71 VAAQLKHARVATLLLPGIGTIHDLRAAYDAGARTVRVATHCTEADISRQHIEYARKLGMDTVGFLMMSH 139 ********************************************************************* PP TIGR03217 139 maspeklaeqakllesyGadvvyvvdsaGallpedvkdrvkalkealkpetevGlhahenlslavansi 207 m++p +la+qa+l+esyGa++vyvvds+Gal+++dv++r++a+k++l+p+te+G+hah+nlsl+vans+ lcl|FitnessBrowser__Cup4G11:RR42_RS05095 140 MTTPAALAQQARLMESYGAQCVYVVDSGGALSMRDVAERFDAFKQVLDPATETGMHAHHNLSLGVANSM 208 ********************************************************************* PP TIGR03217 208 vaveeGatridaslaglGagaGnaplevlvavldrlGletgvdlfklldaaedvvrPlldrpvrvdrea 276 va+e+G++r+daslag+GagaGnaplev++a++dr+G+ +g+dl++l+daa+d+vrPl+drpvrvdre+ lcl|FitnessBrowser__Cup4G11:RR42_RS05095 209 VALEHGCDRVDASLAGMGAGAGNAPLEVFIAAIDRAGIAHGTDLHALMDAADDLVRPLQDRPVRVDRET 277 ********************************************************************* PP TIGR03217 277 ltlGyaGvyssflrhaeraaekygvdardilvelGrrklvgGqedmivdvaldlaker 334 l+lGyaGvyssflrhae+a+++yg+ ++dilvelGrr++vgGqedmivdvaldl+++r lcl|FitnessBrowser__Cup4G11:RR42_RS05095 278 LALGYAGVYSSFLRHAEAASARYGIATVDILVELGRRRMVGGQEDMIVDVALDLLRQR 335 ******************************************************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (334 nodes) Target sequences: 1 (335 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.09 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory