Align 3-hydroxyanthranilate 3,4-dioxygenase; 3-hydroxyanthranilate oxygenase; 3-HAO; 3-hydroxyanthranilic acid dioxygenase; HAD; EC 1.13.11.6 (characterized)
to candidate RR42_RS05080 RR42_RS05080 3-hydroxyanthranilate 3,4-dioxygenase
Query= SwissProt::Q83V26 (185 letters) >FitnessBrowser__Cup4G11:RR42_RS05080 Length = 186 Score = 299 bits (765), Expect = 2e-86 Identities = 136/179 (75%), Positives = 157/179 (87%) Query: 2 MFTFGKPLNFQRWLDDHSDLLRPPVGNQQVWQDSDFIVTVVGGPNFRTDFHDDPMEEFFY 61 MF +G PLNF RWLD+H+ LL+PPVGNQQVWQD+D IVTVVGGPN RTDFHDDP+EEFFY Sbjct: 1 MFIYGMPLNFPRWLDEHAHLLKPPVGNQQVWQDADTIVTVVGGPNQRTDFHDDPLEEFFY 60 Query: 62 QFKGNAYLNIMDRGQMDRVELKEGDIFLLPPHLRHSPQRPEAGSRCLVIERQRPKGMLDG 121 QFKGNA+L+IMDRG+ +RV+LKEGDIFLLP H+RHSPQRPEA SRCLVIERQRP+G++DG Sbjct: 61 QFKGNAWLDIMDRGKRERVDLKEGDIFLLPAHVRHSPQRPEADSRCLVIERQRPEGVVDG 120 Query: 122 FEWYCLSCNGLVYRVDVQLNSIVTDLPPLFDIFYGNVGLRKCPQCGQVHPGKAAIEAVA 180 FEWYC +C+ LVYRV+VQL SIVTDLPPLF FY N LR+C QCG VHPG+A+ A A Sbjct: 121 FEWYCPACSALVYRVEVQLKSIVTDLPPLFAGFYDNAALRRCGQCGTVHPGRASAPAPA 179 Lambda K H 0.325 0.145 0.475 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 185 Length of database: 186 Length adjustment: 19 Effective length of query: 166 Effective length of database: 167 Effective search space: 27722 Effective search space used: 27722 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 44 (21.6 bits)
Align candidate RR42_RS05080 RR42_RS05080 (3-hydroxyanthranilate 3,4-dioxygenase)
to HMM TIGR03037 (nbaC: 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03037.hmm # target sequence database: /tmp/gapView.24336.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03037 [M=159] Accession: TIGR03037 Description: anthran_nbaC: 3-hydroxyanthranilate 3,4-dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-79 252.2 0.0 1.2e-79 252.0 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS05080 RR42_RS05080 3-hydroxyanthranila Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS05080 RR42_RS05080 3-hydroxyanthranilate 3,4-dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 252.0 0.0 1.2e-79 1.2e-79 1 159 [] 8 167 .. 8 167 .. 0.99 Alignments for each domain: == domain 1 score: 252.0 bits; conditional E-value: 1.2e-79 TIGR03037 1 lnlkkwidehkellkppvgnkqiwqdselivtvvGGpnkrtdfhvdeseeffyqlkGemvlkvleeGkv 69 ln+ +w+deh++llkppvgn+q+wqd++ ivtvvGGpn+rtdfh+d+ eeffyq+kG++ l +++ Gk+ lcl|FitnessBrowser__Cup4G11:RR42_RS05080 8 LNFPRWLDEHAHLLKPPVGNQQVWQDADTIVTVVGGPNQRTDFHDDPLEEFFYQFKGNAWLDIMDRGKR 76 79******************************************************************* PP TIGR03037 70 edvpireGdifllppkvphspqra.agsiglvierkrkegeldalqwfcaecgeklyraevklesivkd 137 e+v+++eGdifllp++v+hspqr+ a+s++lvier+r+eg d+++w+c+ c+ +yr+ev+l+siv+d lcl|FitnessBrowser__Cup4G11:RR42_RS05080 77 ERVDLKEGDIFLLPAHVRHSPQRPeADSRCLVIERQRPEGVVDGFEWYCPACSALVYRVEVQLKSIVTD 145 ************************9******************************************** PP TIGR03037 138 lppvfekfyssedartckkcGe 159 lpp+f fy + ++r+c +cG+ lcl|FitnessBrowser__Cup4G11:RR42_RS05080 146 LPPLFAGFYDNAALRRCGQCGT 167 ********************95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (159 nodes) Target sequences: 1 (186 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.80 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory