Align catechol 2,3-dioxygenase (EC 1.13.11.2) (characterized)
to candidate RR42_RS32655 RR42_RS32655 catechol 2,3-dioxygenase
Query= BRENDA::P06622 (307 letters) >FitnessBrowser__Cup4G11:RR42_RS32655 Length = 310 Score = 353 bits (906), Expect = e-102 Identities = 177/307 (57%), Positives = 218/307 (71%), Gaps = 4/307 (1%) Query: 4 GVMRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEP 63 GV+RPGHV LRVL++ AL+HY E+LGLIE RDD+GRVYLKAW E D S+VLREAD P Sbjct: 5 GVLRPGHVALRVLELEPALKHYTEVLGLIETARDDKGRVYLKAWDEHDHHSVVLREADSP 64 Query: 64 GMDFMGFKVVDEDALRQLERDLMAYGCA--VEQLPAGELNSCGRRVRFQAPSGHHFELYA 121 GMD+MGF+V L L +++ G A + +PAGE G R RF P+GH EL+A Sbjct: 65 GMDYMGFRVDSGRTLEWLAQEVEQSGLASDFQWIPAGEHPRTGVRFRFTIPTGHAIELFA 124 Query: 122 DKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVL 181 DK+ G D NP+ WP DL+GMA RFDH L+YGD+L T LF VLGF LAE+V+ Sbjct: 125 DKDKLGCL-TGDSNPDPWPDDLRGMAPSRFDHCLLYGDDLDGTVRLFRDVLGFTLAEEVV 183 Query: 182 DENGTR-VAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSID 240 G + FL+ S KAHD+AFI H EK + HH SF+L+ W ++L+AAD+IS D S+D Sbjct: 184 AGPGKMMIGAFLTCSNKAHDIAFIRHAEKNKFHHASFNLDNWGEVLKAADIISKKDVSLD 243 Query: 241 IGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNE 300 IGPTRHG+T G TIYFFDPSGNRNEVF GG +YPD +TWT ++LGKAIFYHDR LN+ Sbjct: 244 IGPTRHGITRGATIYFFDPSGNRNEVFSGGYIHYPDKPTITWTDNELGKAIFYHDRKLND 303 Query: 301 RFMTVLT 307 F+ VLT Sbjct: 304 AFLNVLT 310 Lambda K H 0.322 0.139 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 310 Length adjustment: 27 Effective length of query: 280 Effective length of database: 283 Effective search space: 79240 Effective search space used: 79240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS32655 RR42_RS32655 (catechol 2,3-dioxygenase)
to HMM TIGR03211 (catechol 2,3 dioxygenase (EC 1.13.11.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03211.hmm # target sequence database: /tmp/gapView.3038.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03211 [M=303] Accession: TIGR03211 Description: catechol_2_3: catechol 2,3 dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-139 449.2 0.0 3.8e-139 449.1 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS32655 RR42_RS32655 catechol 2,3-dioxyg Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS32655 RR42_RS32655 catechol 2,3-dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 449.1 0.0 3.8e-139 3.8e-139 1 303 [] 5 310 .] 5 310 .] 0.99 Alignments for each domain: == domain 1 score: 449.1 bits; conditional E-value: 3.8e-139 TIGR03211 1 gvlrlghvelrvldleealkfykdvlGleetgrdeq.svYlkawdewdkysvilteadkagldhvafkv 68 gvlr+ghv+lrvl+le alk+y++vlGl et+rd++ +vYlkawde+d++sv+l+ead++g+d ++f+v lcl|FitnessBrowser__Cup4G11:RR42_RS32655 5 GVLRPGHVALRVLELEPALKHYTEVLGLIETARDDKgRVYLKAWDEHDHHSVVLREADSPGMDYMGFRV 73 69******************************************************************* PP TIGR03211 69 eseadLeklekkleaaGv..everieagedlevGeavrfelPsgheleLyaekelvgekkgklnpdpwk 135 +s ++Le l++++e++G+ + ++i+age++++G ++rf++P+gh +eL+a+k+ g +g+ npdpw+ lcl|FitnessBrowser__Cup4G11:RR42_RS32655 74 DSGRTLEWLAQEVEQSGLasDFQWIPAGEHPRTGVRFRFTIPTGHAIELFADKDKLGCLTGDSNPDPWP 142 *****************955679********************************************** PP TIGR03211 136 kelkGvaakrldHvlllaedveenvklltevLgfkltEqvvaedgkeqlaaflsvsnkahdiafvkdpe 204 ++l+G+a++r+dH+ll+++d++ +v+l+++vLgf+l+E+vva++gk++++afl++snkahdiaf++++e lcl|FitnessBrowser__Cup4G11:RR42_RS32655 143 DDLRGMAPSRFDHCLLYGDDLDGTVRLFRDVLGFTLAEEVVAGPGKMMIGAFLTCSNKAHDIAFIRHAE 211 ********************************************************************* PP TIGR03211 205 kgklhHvsflldswedvlkaaDvlskndvkidvgptrHgitrgqtiYvfdPsGnrvElfaggylaypdw 273 k+k+hH+sf+ld+w +vlkaaD++sk+dv++d+gptrHgitrg tiY+fdPsGnr+E+f+ggy++ypd+ lcl|FitnessBrowser__Cup4G11:RR42_RS32655 212 KNKFHHASFNLDNWGEVLKAADIISKKDVSLDIGPTRHGITRGATIYFFDPSGNRNEVFSGGYIHYPDK 280 ********************************************************************* PP TIGR03211 274 epitWtedelgrgifyherklnesfltvlt 303 ++itWt++elg++ifyh+rkln++fl+vlt lcl|FitnessBrowser__Cup4G11:RR42_RS32655 281 PTITWTDNELGKAIFYHDRKLNDAFLNVLT 310 **************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (303 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.55 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory