Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate RR42_RS34795 RR42_RS34795 leucine/isoleucine/valine transporter ATP-binding subunit
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__Cup4G11:RR42_RS34795 Length = 254 Score = 220 bits (560), Expect = 3e-62 Identities = 106/248 (42%), Positives = 165/248 (66%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 +L++ ++++FGGL A+ DV IT + G + +IGPNGAGKTTFFN+I G + P +G L Sbjct: 1 MLEIRNLTRKFGGLSAVHDVSITFETGHINAIIGPNGAGKTTFFNLIAGTHAPTSGQILL 60 Query: 69 AGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFK 128 G+ ++A+ G+ARTFQ LF T L+N++VG +RT +GL +F T+ + Sbjct: 61 KGRNVAGLRADQIARLGVARTFQATHLFDRATVLDNLIVGHRLRTQAGLADVIFNTRRLR 120 Query: 129 AEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGM 188 EE +A+E LD+VG+ A A ++ +++R+ A ALATD +L+ LDEPA G+ Sbjct: 121 EEERLCRAKAEEALDFVGLAHLAHEVAADITQEERKRVAFALALATDAELLLLDEPAGGV 180 Query: 189 NATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 N E V L ELI ++ +T+ LIEH + ++M L D++ VL++G++IAEG+PA++Q++ Sbjct: 181 NPEETVGLAELIRKMVRHGKTVCLIEHKMDMIMRLADKIMVLNHGEKIAEGSPAQIQQDP 240 Query: 249 KVIEAYLG 256 +VIEAYLG Sbjct: 241 QVIEAYLG 248 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 254 Length adjustment: 24 Effective length of query: 236 Effective length of database: 230 Effective search space: 54280 Effective search space used: 54280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory