Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate RR42_RS32485 RR42_RS32485 3-keto-5-aminohexanoate cleavage protein
Query= reanno::acidovorax_3H11:Ac3H11_1849 (381 letters) >FitnessBrowser__Cup4G11:RR42_RS32485 Length = 627 Score = 150 bits (378), Expect = 1e-40 Identities = 113/331 (34%), Positives = 157/331 (47%), Gaps = 15/331 (4%) Query: 35 GFEFVEFTSPQPGVLE--AVFEKLGFTLVAKHRSKDVVLYRQNGINFILNREPHSQAAYF 92 G +F+EF E A LGF +HRSK V LYRQ G+N ILN E S AA Sbjct: 288 GVDFLEFAVDYVTGRELGARLRSLGFGHAGRHRSKAVELYRQGGVNIILNAEQDSAAAEH 347 Query: 93 GAEHGPSACGLAFRVKDAHKAYNRALELGAQPIEIPTGPMELRLPAIKGIGGAPLYLIDR 152 HGPS C L +V DA +A RA L + GP E +PA++ G YLID Sbjct: 348 FQLHGPSVCALGLKVDDAQRAVTRARALLCKEWRERIGPHERSIPALRAPDGMLFYLIDE 407 Query: 153 FEDGKSIYDIDFEFIEGVDRRPAGHGLNLIDHLTHNVYRGRMGFWANFYEKLFGFREIRY 212 +SIY+ DF +E AG GL IDH+ + R+ + FY+ +FG + Sbjct: 408 QGSDRSIYESDF-VLEPGGADSAGAGLMAIDHIAQALPPHRLDSFVLFYKTVFGLQAQAL 466 Query: 213 FDIQGEYTGLTSKAMTAPDGKIRIPLN--EESKQGGGQIEEFLMQFNGEGIQHIALICDN 270 +I Y + S+AM + + +RIPLN E S+ G+ F+ + G GI HIA + Sbjct: 467 HEIADPYGLVKSRAMVSAEQSLRIPLNVSESSRTATGR---FITAYAGSGIHHIAFRTPD 523 Query: 271 LLDVVDKLGMAGVQLATAPNEVYYEMLDTRLPGHGQPVPELQSRGILLDGTTADGTPRLL 330 L +D+ A + P+ YY+ + RL + L+ +L D A G Sbjct: 524 LCATLDQAVPAEAAMLHVPDN-YYDDVGARLGLDDAALEHLRQHQLLYD-RDAGGE---F 578 Query: 331 LQIFSTPMLGPVFFEFIQREGDYRDGFGEGN 361 L ++ P FFE +QR+G GFG N Sbjct: 579 LHAYTEPFHDRFFFELVQRDGYL--GFGAAN 607 Lambda K H 0.322 0.142 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 625 Number of extensions: 37 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 627 Length adjustment: 34 Effective length of query: 347 Effective length of database: 593 Effective search space: 205771 Effective search space used: 205771 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory