Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate RR42_RS31975 RR42_RS31975 fatty acid--CoA ligase
Query= reanno::acidovorax_3H11:Ac3H11_3009 (578 letters) >lcl|FitnessBrowser__Cup4G11:RR42_RS31975 RR42_RS31975 fatty acid--CoA ligase Length = 546 Score = 292 bits (748), Expect = 2e-83 Identities = 188/542 (34%), Positives = 279/542 (51%), Gaps = 23/542 (4%) Query: 27 IEQTIGAFFADMVARQPERE-ALVSVHQ-GRRYTYAQLQTEAHRLASALLGMGLTPGDRV 84 I TI A ++V R A +++ + G R ++ +L T + ALL +GL PGDRV Sbjct: 23 IPATIPATIPELVRTAAARHGARIAIQEDGLRLSFTELDTLRAQAGRALLALGLLPGDRV 82 Query: 85 GIWSHNNAEWVLMQLATAQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSMARFKTSDYL 144 +W+ N +EW++ LA +G LV IN + E L G ++L + F Y Sbjct: 83 AVWAPNLSEWIVAALAAHSIGAALVPINTRMKGMEAGAILADSGARVLFCIDNFLGESYP 142 Query: 145 GMLRELAPEWQGQQPGHLQAAKLPQLKTVVWIDDEAGQ--GADEPGLLRFTELIARGNAA 202 ML AP +PG L+ +V + AG+ DE F L A+ A Sbjct: 143 EML---APH----RPGTLER--------IVVLRGRAGRQMAPDELAWADFLALAAQTGEA 187 Query: 203 DPRLAQVAAGLQATDPINIQFTSGTTGFPKGATLTHRNILNNGFFIGECMKLTPADRLCI 262 R + A + ++I FTSGTTG PKG H L + DR I Sbjct: 188 AFRACESA--VSGDTLMDIMFTSGTTGRPKGVMTAHAQNLQAIHGWASITGVEAGDRYLI 245 Query: 263 PVPLYHCFGMVLGNLACFTHGATIVYPNDGFDPLTVLQTVQDERCTGLHGVPTMFIAELD 322 P +H FG G LA GATI+ P+ FD V+ +++ER T L G PT++ L+ Sbjct: 246 VNPFFHTFGYKAGWLAALASGATIL-PHLVFDAEAVMTRIENERITVLPGPPTLYQTLLN 304 Query: 323 HPRFAEFNLSTLRTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTETSPVSCQSSTDTP 382 HPR EF+LS+LR + S P +++R+ ++ R+I YG+TE+ + + Sbjct: 305 HPRLREFDLSSLRVAVTGASAIPPVLIQRMRRELGFRDIFTGYGLTESCGFATLTRAADD 364 Query: 383 LSKRVSTVGQVQPHLEVKIVDPDTGAVVPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDE 442 T G+ P +E++ VD G VP G+ GE +GY+VM GY+ T EAID Sbjct: 365 ADIVALTSGRAMPGVELRCVD-GAGYPVPAGEPGEVTVRGYNVMRGYFQLPEATTEAIDA 423 Query: 443 GGWMHTGDLATMDAEGYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPD 502 GGW+ TGD+ T+D G + I RIKDM I GG N YP EIE+ L HP + V VVGVP Sbjct: 424 GGWLRTGDIGTLDVRGNLRITDRIKDMFIVGGFNCYPAEIEKLLVSHPAIAQVAVVGVPH 483 Query: 503 QKYGEELCAWIIAKPGTQPTEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKI 562 ++ GE A+++ + G++ D++ + + +A+YKVPR + FV + P + GKI K+++ Sbjct: 484 ERLGEAGKAFVVLRHGSKVGADELIDWARRHMANYKVPREVVFVQTLPTSAAGKILKYRL 543 Query: 563 RD 564 R+ Sbjct: 544 RE 545 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 738 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 578 Length of database: 546 Length adjustment: 36 Effective length of query: 542 Effective length of database: 510 Effective search space: 276420 Effective search space used: 276420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory