Align Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 (characterized)
to candidate RR42_RS09905 RR42_RS09905 fumarylacetoacetase
Query= SwissProt::P25093 (419 letters) >FitnessBrowser__Cup4G11:RR42_RS09905 Length = 437 Score = 338 bits (868), Expect = 1e-97 Identities = 191/427 (44%), Positives = 254/427 (59%), Gaps = 25/427 (5%) Query: 7 AEDSDFPIQNLPYGVFSTQSNPKP-RIGVAIGDQILDLSVIKHLFTGPVL----SKHQHV 61 A DFP+QNLP VF + + + R GVAIGDQI+DL ++ L P L ++ Sbjct: 20 AAGCDFPLQNLPLSVFRRKGSTEAWRGGVAIGDQIVDLGALQSL---PGLQDSAAEAVRA 76 Query: 62 FDETTLNSFMGLGQAAWKEARASLQNLLSASQAQLRDDKELRQRAFTSQASATMHLPATI 121 TLN + LG +W+ R L LL + + R +E A Q A +P I Sbjct: 77 AAAPTLNGLLELGPESWRALRHGLYGLLQSGSSLARQVRE----ALVPQLDAEHAVPVRI 132 Query: 122 GDYTDFYSSLQHATNVGIMFRGKENALLPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMR 181 GDYTDFY+SL HA N F + N PN+ LP+ YHGR SS+ VSG + RP GQ R Sbjct: 133 GDYTDFYTSLDHAVNCCRQFGIEVN---PNFDWLPIAYHGRVSSIDVSGQQVYRPAGQYR 189 Query: 182 PDNSKPPVYGASKRLDMELEMAFFVGPGNRFGEPIPISKAQEHIFGMVLMNDWSARDIQQ 241 D S PVYG +RLD ELE+ +G GN G PIP++ AQ+HIFG+ L+NDWSARDIQ Sbjct: 190 TDPSSAPVYGPCQRLDYELEVGAVIGIGNARGTPIPLANAQQHIFGLCLLNDWSARDIQT 249 Query: 242 WEYVPLGPFLGKSFGTTISPWVVPMDALMPFVV--PNPKQDPKPLPYL---CHSQPYTFD 296 WE PLGPFL K+F TT+SPW+V ++AL+P+ + P+PL YL ++ FD Sbjct: 250 WEMQPLGPFLAKNFATTLSPWIVTLEALLPYRTGWTRAPERPQPLDYLRSADNAAAGAFD 309 Query: 297 INLSVA-LKGEGMSQAA---TICRSNFKHMYWTILQQLTHHSVNGCNLRPGDLLASGTIS 352 I L V+ L +Q + R++F+H YWT+ Q + HH+V GCNL+PGDLL SGT+S Sbjct: 310 IQLEVSILSARRQAQGRPPHKLTRTSFQHQYWTLGQMIAHHTVGGCNLQPGDLLGSGTVS 369 Query: 353 GSDPESFGSMLELSWKGTKAIDVGQGQTRTFLLDGDEVIITGHCQGDGY-RVGFGQCAGK 411 G +P G+++EL+ GT D+G G+ R FL DGD V+ G C+ + Y R+GFG Sbjct: 370 GPNPWEAGALIELTVSGTHPADIGDGEQRGFLKDGDTVVFRGWCEREDYARIGFGVNYAT 429 Query: 412 VLPALSP 418 VLPA P Sbjct: 430 VLPAPGP 436 Lambda K H 0.320 0.136 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 582 Number of extensions: 29 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 437 Length adjustment: 32 Effective length of query: 387 Effective length of database: 405 Effective search space: 156735 Effective search space used: 156735 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate RR42_RS09905 RR42_RS09905 (fumarylacetoacetase)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.1159.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-143 464.5 0.0 1.8e-143 464.3 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS09905 RR42_RS09905 fumarylacetoacetase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS09905 RR42_RS09905 fumarylacetoacetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 464.3 0.0 1.8e-143 1.8e-143 1 419 [. 13 433 .. 13 434 .. 0.93 Alignments for each domain: == domain 1 score: 464.3 bits; conditional E-value: 1.8e-143 TIGR01266 1 sfvavak..nsdfplqnlPyGvfstkads.srrigvaiGdqildlskiaaaglfeglalkehqevfkes 66 s++++a+ +dfplqnlP+ vf k ++ r gvaiGdqi+dl ++++ ++++ ++ e+ + lcl|FitnessBrowser__Cup4G11:RR42_RS09905 13 SWLDSANaaGCDFPLQNLPLSVFRRKGSTeAWRGGVAIGDQIVDLGALQSLPGLQD-SAAEAVRAAAAP 80 79988885467************976544156899***************888887.567788889999 PP TIGR01266 67 tlnaflalgrparkevrerlqkllsesaevlrdnaalrkeallaqaeatmhlPaqiGdytdfyssirha 135 tln +l lg +++++r+ l ll + + a++ +eal++q +a+ +P++iGdytdfy+s+ ha lcl|FitnessBrowser__Cup4G11:RR42_RS09905 81 TLNGLLELGPESWRALRHGLYGLLQSGSSL----ARQVREALVPQLDAEHAVPVRIGDYTDFYTSLDHA 145 ************************976666....777889***************************** PP TIGR01266 136 tnvGilfrgkdnallPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkldlelela 204 n f + Pn+ +lP++yhGr ss+ vsG ++ rP Gq ++d ++ Pv+gpc++ld+ele++ lcl|FitnessBrowser__Cup4G11:RR42_RS09905 146 VNCCRQFG---IEVNPNFDWLPIAYHGRVSSIDVSGQQVYRPAGQYRTDPSSAPVYGPCQRLDYELEVG 211 ****9998...5678****************************************************** PP TIGR01266 205 ffvgtenelGeavpiekaeehifGvvllndwsardiqaweyvPlGPflaksfattvsPwvvsiealePf 273 +g +n+ G+++p+ +a++hifG++llndwsardiq+we +PlGPflak+fatt+sPw+v++eal P+ lcl|FitnessBrowser__Cup4G11:RR42_RS09905 212 AVIGIGNARGTPIPLANAQQHIFGLCLLNDWSARDIQTWEMQPLGPFLAKNFATTLSPWIVTLEALLPY 280 ********************************************************************* PP TIGR01266 274 rvaqlePeqdpkplpylredr..adtafdielevslkteGlae....aavisrsnakslywtlkqqlah 336 r+ ++ ++p+pl ylr + a afdi+levs+ ++ + +++++r+ +++ ywtl q++ah lcl|FitnessBrowser__Cup4G11:RR42_RS09905 281 RTGWTRAPERPQPLDYLRSADnaAAGAFDIQLEVSILSARRQAqgrpPHKLTRTSFQHQYWTLGQMIAH 349 ***99*9**********975435889**********987654456779********************* PP TIGR01266 337 hsvnGcnlraGdllgsGtisGkeeeafGsllelsakGkkevkladgetrkfledGdevilrgvckkeGv 405 h+v Gcnl++GdllgsGt+sG+++ + G+l+el+ G+++ +++dge+r fl+dGd+v++rg c++e + lcl|FitnessBrowser__Cup4G11:RR42_RS09905 350 HTVGGCNLQPGDLLGSGTVSGPNPWEAGALIELTVSGTHPADIGDGEQRGFLKDGDTVVFRGWCEREDY 418 ******************************************************************998 PP TIGR01266 406 r.vGfGecaGkvlpa 419 +GfG +vlpa lcl|FitnessBrowser__Cup4G11:RR42_RS09905 419 ArIGFGVNYATVLPA 433 77***********97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (437 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.88 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory