Align isobutyryl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate RR42_RS11345 RR42_RS11345 acyl-CoA dehydrogenase
Query= reanno::pseudo3_N2E3:AO353_25670 (383 letters) >FitnessBrowser__Cup4G11:RR42_RS11345 Length = 378 Score = 267 bits (683), Expect = 3e-76 Identities = 141/372 (37%), Positives = 212/372 (56%), Gaps = 1/372 (0%) Query: 7 TEEQVMIRDMARDFARGEIAPHAQAWEKAGWIDDALVAKMGELGLLGMVVPEEWGGTYVD 66 TEE M+R AR F E+APH + WE+ G++D + K G G L +PE++GG D Sbjct: 8 TEEHEMLRTAARRFMETEVAPHHERWEEQGYVDRDVWLKAGAAGFLCASMPEQYGGAGGD 67 Query: 67 YVAYALAVEEISAGDGATGALMSIHNSVGCGPVLNYGTEEQKQTWLADLASGQAIGCFCL 126 + Y++ + E A G TG +H+ + + +YG+E K +L +A+G+ IG + Sbjct: 68 KL-YSVVLMEEQARAGCTGLGFGLHSEIVAPYIEHYGSEYLKSAYLPKMAAGEMIGAIAM 126 Query: 127 TEPQAGSEAHNLRTRAELRDGQWVINGAKQFVSNGRRAKLAIVFAVTDPDLGKKGLSAFL 186 TEP GS+ ++ A +++NG+K F++NG A L IV A TDP G KG+S F+ Sbjct: 127 TEPGTGSDLQGIKATAVRHGDHYLLNGSKTFITNGWHADLVIVVAKTDPQAGAKGISLFV 186 Query: 187 VPTDTPGFIVDRSEHKMGIRASDTCAVTLNNCTIPEANLLGERGKGLAIALSNLEGGRIG 246 V T PGF + K G++A DT + +N +P ANLLG+ G+G + L R+ Sbjct: 187 VDTSMPGFSKGKRLKKAGMKAQDTAELFFDNVRVPVANLLGDEGQGFGYLMRELSWERLQ 246 Query: 247 IAAQALGIARAAFEAALAYARDRVQFDKPIIEHQSVANMLADMHTRLNAARLLILHAARL 306 IA A+ A E LAY RDR F +PI E Q+VA+ LAD+ T L R+ + +L Sbjct: 247 IAITAVAAVEAGLEWTLAYTRDRKAFKRPISEFQTVAHALADIRTELEMGRVFVDRCLQL 306 Query: 307 RSAGKPCLSEASQAKLFASEMAEKVCSSAIQIHGGYGYLEDYPVERYYRDARITQIYEGS 366 GK + AS AK + +EM + +Q+HGGYGY+ +YP+ R + DAR+ +IY G+ Sbjct: 307 VLEGKLDAATASMAKYWTTEMQFRALDRCVQLHGGYGYMWEYPITRAWADARVQRIYGGA 366 Query: 367 SEIQRMVIAREL 378 +EI + +I+R L Sbjct: 367 NEIMKELISRNL 378 Lambda K H 0.319 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 378 Length adjustment: 30 Effective length of query: 353 Effective length of database: 348 Effective search space: 122844 Effective search space used: 122844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory