Align 2-methylbutanoyl-CoA dehydrogenase / butanoyl-CoA dehydrogenase / isobutyryl-CoA dehydrogenase (EC 1.3.8.1; EC 1.3.8.5) (characterized)
to candidate RR42_RS24965 RR42_RS24965 acyl-CoA dehydrogenase
Query= reanno::pseudo3_N2E3:AO353_25680 (375 letters) >FitnessBrowser__Cup4G11:RR42_RS24965 Length = 385 Score = 288 bits (736), Expect = 2e-82 Identities = 153/366 (41%), Positives = 229/366 (62%), Gaps = 2/366 (0%) Query: 12 DAARQFAQERLKPFAAEWDREHRFPKEAIGEMAELGFFGMLVPEQWGGCDTGYLAYAMAL 71 D+ R+F +ERL P A P++ + +M ++G FGM +PE++GG + + Sbjct: 13 DSVRRFVRERLVPAEALVAETDEIPQDIVQDMRDMGLFGMTIPERFGGLELTMEEEVRVV 72 Query: 72 EEIAAGDGACSTIMSVHNSVGCVPILKFGNDDQKERFLKPLASGAMLGAFALTEPQAGSD 131 E+ A +++ +G IL G +Q+ +L LA+G +L +FALTEP AGSD Sbjct: 73 MELCQTSPAFRSLLGTTVGIGSQGILMDGTPEQQAAWLPRLATGEILASFALTEPDAGSD 132 Query: 132 ASSLKTRARLNGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSA-GKRGISAFIVPTDSPG 190 A SL+T A +GDHYV+NG K+FIT+ AG+ + A T+P G G+SAFIV +PG Sbjct: 133 AGSLRTSAIKDGDHYVVNGTKRFITNAPQAGMFTLMARTNPDIKGSAGVSAFIVDAKTPG 192 Query: 191 YKVARVEDKLGQHASDTCQILFEDVQVPVANRLG-EEGEGYKIALANLEGGRVGIASQSV 249 + + K+GQ + TC ++FE+V+VP AN +G +EG+G+K A+ L+ GR+ IA+ SV Sbjct: 193 ISFGKRDVKMGQKGAHTCDVIFENVRVPAANLIGLKEGQGFKTAMKVLDKGRLHIAAVSV 252 Query: 250 GMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAALRDSGKP 309 G+AR A +YA ER+ FG+PI E Q + LAD ++ A MV AA RD G+ Sbjct: 253 GVARRVLRDALNYALERKQFGQPISEFQLIQAMLADSQAELYAAECMVIDAARRRDEGRN 312 Query: 310 ALVEASMAKLFASEMAEKVCSTALQTLGGYGYLSDFPLERIYRDVRVCQIYEGTSDIQRM 369 EAS K+FA+EM +V A+Q LGG GY+S++ +ER YRDVR+ ++YEGT+ IQ++ Sbjct: 313 VSTEASCCKMFATEMVGRVADRAVQILGGSGYISEYGIERFYRDVRLFRLYEGTTQIQQI 372 Query: 370 VISRNL 375 +I+RN+ Sbjct: 373 IIARNM 378 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 385 Length adjustment: 30 Effective length of query: 345 Effective length of database: 355 Effective search space: 122475 Effective search space used: 122475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory