Align branched-chain-2-oxoacid decarboxylase (subunit 2/2) (EC 4.1.1.72) (characterized)
to candidate RR42_RS21785 RR42_RS21785 MFS transporter
Query= BRENDA::Q9HIA4 (319 letters) >FitnessBrowser__Cup4G11:RR42_RS21785 Length = 729 Score = 195 bits (496), Expect = 2e-54 Identities = 116/292 (39%), Positives = 167/292 (57%), Gaps = 6/292 (2%) Query: 4 VQALNSAMDLKMSEDDSVIILGEDVGR-DGGVFRVTDGLQAKYGPQRVIDTPLSELGIVG 62 + + M +M D SV+++GEDV R GG T GL+ + P RV+ TP+SE VG Sbjct: 405 IDVVADVMQRRMETDPSVVVMGEDVHRLKGGTNGATRGLRDNF-PDRVLGTPISENAFVG 463 Query: 63 MAIGMAVNG-LKPIPEIQFQDFIYTSMDQIINQMAKIRYRSGGDYTVPLVLRTPVGGGIK 121 + G+A++G KP+ E + DF++ + DQ+ NQ+ K R+ GG+ VPLVLRT V G Sbjct: 464 LGGGLALDGRYKPVVEFMYPDFMWVAADQVFNQIGKARHMFGGESDVPLVLRTKVAMGTG 523 Query: 122 GGLYHSQSGEAYFAHTAGLTVVSPSNPYDAKGLLISAIESPDPVIFLEPKRLYRAQKV-E 180 G HS FA G +V+PS P+D GL+ +A+ DPV+ +E LY A V Sbjct: 524 YGSQHSMDPAGIFATNPGWRIVAPSTPFDYVGLMNTALACKDPVLVIEHVDLYNASGVGP 583 Query: 181 VPDEKYTIPLRKANVLKQGNDVTIVTYGSMVPTVMSVASKSKYDVEVIDLRTI--APMDR 238 V D Y +P+ KA V + G+DVT++TY SMV + ++ D EVIDLR + A +D Sbjct: 584 VDDFDYHLPVGKAAVRRGGSDVTVITYLSMVGHSLEAVEQTGIDAEVIDLRWLDRASIDW 643 Query: 239 DTIISSVKKTGRVVIVHEAPRTLGVGAEISAMISERAIEYLYAPIVRVTGPD 290 DTI SV+KT V+IV + R G ++ I R ++L P+ RVTG + Sbjct: 644 DTIAQSVRKTNNVLIVEQGARGTSYGGWLADEIQRRYFDWLDQPVQRVTGAE 695 Lambda K H 0.318 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 729 Length adjustment: 34 Effective length of query: 285 Effective length of database: 695 Effective search space: 198075 Effective search space used: 198075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory