Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate RR42_RS34800 RR42_RS34800 leucine/isoleucine/valine transporter ATP-binding subunit
Query= TCDB::P21630 (233 letters) >FitnessBrowser__Cup4G11:RR42_RS34800 Length = 235 Score = 225 bits (574), Expect = 5e-64 Identities = 108/235 (45%), Positives = 168/235 (71%), Gaps = 2/235 (0%) Query: 1 MLSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRY 60 ML ++VS YG +AL ++++ GE+V L+GANGAGKS++ M L G + + GS+R+ Sbjct: 1 MLQLERVSLSYGSFRALDNITLNAAAGELVVLLGANGAGKSSIFMALSGIHRTSGGSMRF 60 Query: 61 EGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQ--MDKVLE 118 +G EL G+ S I++ + PEGR++F ++V++NL +G + +D ++ ++ V E Sbjct: 61 DGRELAGMKPSQIVQAGLVHCPEGRKLFPAMSVQKNLTLGAYVHRRDSAGIKRSLEDVFE 120 Query: 119 LFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQ 178 +FP L+++ + AG++SGG+QQM+A+GRALM +P+ LLLDEPSLGLAP++++Q+FE+I++ Sbjct: 121 MFPILRQKKDDPAGSLSGGQQQMVALGRALMGRPRTLLLDEPSLGLAPLVVKQMFEVIQR 180 Query: 179 LRREGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRDAYLGG 233 + R G TV L EQNA AL +A RAYV+E+GRIVM ALL + +R AY+GG Sbjct: 181 INRAGTTVLLAEQNAYAALGIAHRAYVIESGRIVMQGDRDALLKDEGIRRAYIGG 235 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 235 Length adjustment: 23 Effective length of query: 210 Effective length of database: 212 Effective search space: 44520 Effective search space used: 44520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory