Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate RR42_RS16970 RR42_RS16970 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__Cup4G11:RR42_RS16970 Length = 386 Score = 263 bits (672), Expect = 7e-75 Identities = 159/346 (45%), Positives = 215/346 (62%), Gaps = 33/346 (9%) Query: 117 LYPMVVVAIKGPQGSLTYVDNFGIQIL----IYVMLAWGLNIVVGLAGLLDLGYVAFYAV 172 L +++A+ P T N+ +++L IY+MLA GLNIVVG AGLLDLGY+AFYAV Sbjct: 26 LLGFLIIALCAPFLVQTLGGNYWVRVLDFALIYIMLALGLNIVVGFAGLLDLGYIAFYAV 85 Query: 173 GAYSYALLSSY----------------FGLSFWVLLPLSGIFAALWGVILGFPVLRLRGD 216 GAY ALL S LS W +LPL+ + AA +GV+LG P L+LRGD Sbjct: 86 GAYMMALLGSPHLANQFEWIHQLFPNGLHLSMWFVLPLAVLVAATFGVLLGAPTLKLRGD 145 Query: 217 YLAIVTLAFGEIIRLVLINWT---DVTKGTFGISSIPKATLFGIPFDATAGGFAKLFHLP 273 YLAIVTL FGEIIR+ L N ++T G GI+++ +FG F + ++F L Sbjct: 146 YLAIVTLGFGEIIRIFLNNLDRPLNITNGPKGITAVDPVHIFGFDFSKSH----EIFGLK 201 Query: 274 ISSAYYKIFLFYLILALCMLTAYVTIRLRRMPIGRAWEALREDEIACRSLGINTVTTKLT 333 + + +YL++ L + ++ +RL+ IGRA+ A+REDEIA +++GINT KL Sbjct: 202 FTPVF---MYYYLLVVLVIAIVFICLRLQNSRIGRAFVAIREDEIAAKAMGINTRNIKLL 258 Query: 334 AFATGAMFAGFAGSFFAARQGFVSPESFVFLESAVILAIVVLGGMGSLTGIAIAAIVMVG 393 AFA GA F G +G+ F A QGFVSPESFV ES ILAIVVLGGMG + G+ + I++VG Sbjct: 259 AFAMGASFGGASGAVFGAFQGFVSPESFVLWESIYILAIVVLGGMGHIPGVILGGILLVG 318 Query: 394 GTELLREMS--FLKLIFGPDFT-PELYRMLIFGLAMVVVMLFKPRG 436 ELLR ++ +IFG E+ R L+FGLA+V VML++P G Sbjct: 319 FQELLRAVAEPAQNMIFGHTIVDAEVLRQLLFGLALVGVMLYRPAG 364 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 567 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 386 Length adjustment: 32 Effective length of query: 431 Effective length of database: 354 Effective search space: 152574 Effective search space used: 152574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory