Align 3-hydroxyisobutyrate dehydrogenase subunit (EC 1.1.1.31) (characterized)
to candidate RR42_RS25325 RR42_RS25325 3-hydroxyisobutyrate dehydrogenase
Query= metacyc::MONOMER-11664 (295 letters) >FitnessBrowser__Cup4G11:RR42_RS25325 Length = 293 Score = 311 bits (798), Expect = 9e-90 Identities = 155/292 (53%), Positives = 210/292 (71%) Query: 1 MRIAFIGLGNMGAPMARNLIKAGHQLNLFDLNKTVLAELAELGGQISPSPKDAAANSELV 60 M+I FIGLG+MG PMA NL+++G+ +++FD + + E G + S D AA ++V Sbjct: 1 MKIGFIGLGHMGLPMASNLLRSGNAVHVFDTSSQAIGLAVERGAIATGSIADLAAAVDVV 60 Query: 61 ITMLPAAAHVRSVYLNDDGVLAGIRPGTPTVDCSTIDPQTARDVSKAAAAKGVDMGDAPV 120 ITMLP A VRSV DGVLA + GT ++CST DPQTARD+ A + G M DAPV Sbjct: 61 ITMLPNPAIVRSVVAGPDGVLAHAKDGTLIIECSTSDPQTARDLESMAQSSGKAMIDAPV 120 Query: 121 SGGTGGAAAGTLTFMVGASAELFASLKPVLEQMGRNIVHCGEVGTGQIAKICNNLLLGIS 180 SGG GA AGTLTFMVG + E F + +P+L MG+NIV+CG G+GQ AKICNNLLLG+S Sbjct: 121 SGGVPGAEAGTLTFMVGGTEEAFVAARPILMAMGKNIVNCGPAGSGQAAKICNNLLLGVS 180 Query: 181 MIGVSEAMALGNALGIDTKVLAGIINSSTGRCWSSDTYNPWPGIIETAPASRGYTGGFGA 240 I VSE+M LG +LG+ VLA IIN+S+GRCW S+ YNP+PG++++APAS ++GGF Sbjct: 181 TIAVSESMCLGVSLGLAPDVLAAIINTSSGRCWVSEVYNPYPGVVKSAPASNDFSGGFAC 240 Query: 241 ELMLKDLGLATEAARQAHQPVILGAVAQQLYQAMSLRGEGGKDFSAIVEGYR 292 +LM+KDL LA +AA QP+ + A+++QL+Q +SL+GEG KD +AIV+ ++ Sbjct: 241 DLMIKDLSLALDAASGTRQPLPMTALSKQLFQLLSLKGEGSKDITAIVQMFK 292 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 293 Length adjustment: 26 Effective length of query: 269 Effective length of database: 267 Effective search space: 71823 Effective search space used: 71823 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS25325 RR42_RS25325 (3-hydroxyisobutyrate dehydrogenase)
to HMM TIGR01692 (mmsB: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01692.hmm # target sequence database: /tmp/gapView.26873.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01692 [M=288] Accession: TIGR01692 Description: HIBADH: 3-hydroxyisobutyrate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-113 365.1 7.2 1.5e-113 364.9 7.2 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS25325 RR42_RS25325 3-hydroxyisobutyrat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS25325 RR42_RS25325 3-hydroxyisobutyrate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 364.9 7.2 1.5e-113 1.5e-113 1 287 [. 5 291 .. 5 292 .. 1.00 Alignments for each domain: == domain 1 score: 364.9 bits; conditional E-value: 1.5e-113 TIGR01692 1 fiGlGnmGgpmaanllkaghavrvfdlsakaveelveaGaqaaasaaeaveeadvvitmlPagkhvesv 69 fiGlG mG pma nll++g av+vfd s++a+ +ve Ga a+ s a+ ++ +dvvitmlP + v+sv lcl|FitnessBrowser__Cup4G11:RR42_RS25325 5 FIGLGHMGLPMASNLLRSGNAVHVFDTSSQAIGLAVERGAIATGSIADLAAAVDVVITMLPNPAIVRSV 73 9******************************************************************** PP TIGR01692 70 yagdegilakvkkksllidsstidvdsarkvaeeaaakGavfldaPvsGGvggaraGtltfmvGgeaee 138 ag +g+la++k ++l+i++st d+++ar + a++ G+ ++daPvsGGv ga+aGtltfmvGg++e+ lcl|FitnessBrowser__Cup4G11:RR42_RS25325 74 VAGPDGVLAHAKDGTLIIECSTSDPQTARDLESMAQSSGKAMIDAPVSGGVPGAEAGTLTFMVGGTEEA 142 ********************************************************************* PP TIGR01692 139 faraepvleamgknivhaGdaGaGqaakiCnnlllgismiGvaealalgeklGldpkvlaeilskssGr 207 f +a+p+l amgkniv +G aG+GqaakiCnnlllg+s i v+e++ lg+ lGl+p+vla i+++ssGr lcl|FitnessBrowser__Cup4G11:RR42_RS25325 143 FVAARPILMAMGKNIVNCGPAGSGQAAKICNNLLLGVSTIAVSESMCLGVSLGLAPDVLAAIINTSSGR 211 ********************************************************************* PP TIGR01692 208 cWsldtynPvPGvveqaPasngykgGfatalmlkdlglaqeaaksvkasvllGalarelyslfaskgag 276 cW ++ ynP+PGvv++aPasn+++gGfa +lm kdl la +aa +++++++ al+++l++l + kg g lcl|FitnessBrowser__Cup4G11:RR42_RS25325 212 CWVSEVYNPYPGVVKSAPASNDFSGGFACDLMIKDLSLALDAASGTRQPLPMTALSKQLFQLLSLKGEG 280 ********************************************************************* PP TIGR01692 277 kkdfsavikll 287 kd +a+++++ lcl|FitnessBrowser__Cup4G11:RR42_RS25325 281 SKDITAIVQMF 291 ********987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (288 nodes) Target sequences: 1 (293 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.67 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory