Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate RR42_RS37305 RR42_RS37305 sulfate ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >FitnessBrowser__Cup4G11:RR42_RS37305 Length = 366 Score = 223 bits (567), Expect = 8e-63 Identities = 124/289 (42%), Positives = 181/289 (62%), Gaps = 21/289 (7%) Query: 2 AGIKIDKINKFYGTT---QALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSG 58 A + ++++ K +G QAL ++L + GE + +GPSGCGK+TLLR +AGLE +G Sbjct: 11 AFLAVEQVGKRFGGAGGFQALDGVSLSVAQGELLCLLGPSGCGKTTLLRIIAGLEREDTG 70 Query: 59 RIEIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAA 118 RI GGR++T + P RD ++FQSYAL+P+++V N+ +G++ G R+ R+AE Sbjct: 71 RIHAGGRELTGLPPQARDYGILFQSYALFPNLSVARNVAYGLQGRGMGRAHREARVAEML 130 Query: 119 RVLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEG 178 ++ L + PGQLSGGQ+QRVA+ RA+ PS+ L DEP+S LDA++R +R+EL Sbjct: 131 SLVGLAGSERKFPGQLSGGQQQRVALARALAPAPSLLLLDEPMSALDARVREHLRLELRQ 190 Query: 179 LHKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGS-- 236 L ++L T + VTHDQ EAM MAD+I V+ GRI QVG+P ++Y +P S FVAEFIG Sbjct: 191 LQRRLNVTTVMVTHDQDEAMAMADRIAVMEGGRIAQVGTPGEIYERPASAFVAEFIGQAN 250 Query: 237 ------PAMNVFSSDVGLQDISLDAS--------AAFVGCRPEHIEIVP 271 + FS VG D+++ + AA + CRPE I + P Sbjct: 251 WLDGRLSGRDTFS--VGELDLAVSPARASEVADGAARLCCRPEAIRLHP 297 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 20 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 366 Length adjustment: 29 Effective length of query: 309 Effective length of database: 337 Effective search space: 104133 Effective search space used: 104133 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory