Align Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE; KDG aldolase YagE; Putative 2-dehydro-3-deoxy-D-pentonate aldolase YagE; EC 4.1.2.51; EC 4.1.2.28 (characterized)
to candidate RR42_RS04230 RR42_RS04230 dihydrodipicolinate synthase
Query= SwissProt::P75682 (302 letters) >FitnessBrowser__Cup4G11:RR42_RS04230 Length = 302 Score = 101 bits (251), Expect = 2e-26 Identities = 73/223 (32%), Positives = 109/223 (48%), Gaps = 8/223 (3%) Query: 7 FTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIAR 66 F+GI P+ T F ADG +D P A L+ +G+ G+ GS GE + L E+ A+ Sbjct: 11 FSGIWLPLVTPF-ADGSVDFPALARLVAHYAGSGIAGIVVCGSTGEAAALDEAEQLAVLD 69 Query: 67 FAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQ 126 + +PV++G G+ ++ + G++ PYY + S+A L+ YF Sbjct: 70 TVLASAGS-LPVMMGVAGSQVKQVQARVRRLAGLPLAGLLAPAPYYVRPSQAGLLDYFRT 128 Query: 127 VADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKGA 186 +ADS P++LY+ P TG L + LA + NI IKD +++I A Sbjct: 129 LADSAAAPLVLYDIPYRTGVKLETETILALA-AHPNIRAIKDCGGDYHGTQAVI-----A 182 Query: 187 HPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKA 229 +VL G D L TL LGG GAI AS + P + V L +A Sbjct: 183 DARLSVLAGEDHQLLGTLCLGGAGAIIASAHLYPALFVALAQA 225 Lambda K H 0.320 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 302 Length adjustment: 27 Effective length of query: 275 Effective length of database: 275 Effective search space: 75625 Effective search space used: 75625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory