Align Probable 2-dehydro-3-deoxy-D-pentonate aldolase YjhH; EC 4.1.2.28 (characterized)
to candidate RR42_RS36370 RR42_RS36370 dihydrodipicolinate synthase
Query= SwissProt::P39359 (301 letters) >FitnessBrowser__Cup4G11:RR42_RS36370 Length = 308 Score = 122 bits (307), Expect = 8e-33 Identities = 79/242 (32%), Positives = 124/242 (51%), Gaps = 4/242 (1%) Query: 4 FSGIIPPVSSTFHRDGTLDKKAMREVADFLINKGVDGLFYLGTGGEFSQMNTAQRMALAE 63 +SG+ P VS+ F D +LD +A +V L+ GV GL GT GE + M+ +++A+ E Sbjct: 8 WSGVFPAVSTQFKADYSLDIEATHKVMCNLVADGVCGLVVCGTVGENTSMSAREKLAVIE 67 Query: 64 EAVTIVDGRVPVLIGVGSPSTDEAVKLAQHAQAYGADGIVAINPYYWKVAPRNLDDYYQQ 123 A GRVPV+ G+ +T A + A G DG++ + + P +++ Sbjct: 68 AAKDAARGRVPVIAGIAEFTTAFARDMVTEAARAGVDGVMVMPALVYSAKPHEAAAHFRD 127 Query: 124 IARSVTLPVILYNFPDLTGQDLTPETVTRLALQNENIVGIKDTIDSVGHLRTMINTVKSV 183 IA + LPV+LYN P + D+TP+ + LA ENIV K DS G R I+ +V Sbjct: 128 IATATDLPVMLYNNPPVYRSDITPDILVSLA-DCENIVCFK---DSSGDTRRFIDLRNAV 183 Query: 184 RPSFSVFCGYDDHLLNTMLLGGDGAITASANFAPELSVGIYRAWREGDLATAATLNKKLL 243 F +F G DD +L ++ +G DG I+ +N P+ ++R R+ A L + + Sbjct: 184 GDRFVLFAGLDDVVLESIAVGADGWISGMSNAFPKEGETLFRLARQRRFDEALALYRWFM 243 Query: 244 QL 245 L Sbjct: 244 PL 245 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 308 Length adjustment: 27 Effective length of query: 274 Effective length of database: 281 Effective search space: 76994 Effective search space used: 76994 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory