Align SDR family oxidoreductase (characterized, see rationale)
to candidate RR42_RS23420 RR42_RS23420 3-oxoacyl-ACP reductase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Cup4G11:RR42_RS23420 Length = 266 Score = 150 bits (379), Expect = 3e-41 Identities = 94/262 (35%), Positives = 145/262 (55%), Gaps = 16/262 (6%) Query: 6 GRLAGKTVLITAAA-----QGIGRASTELFAREGARVIATDISKTH----LEELASIAG- 55 GRL GK V++T A G GRA FA EGA+V A D ++ L+ LA++ G Sbjct: 3 GRLEGKVVIVTGAGCVGPGWGNGRAVAVRFAEEGAKVFAVDKNQDPMVETLDRLAAVGGE 62 Query: 56 VETHLLDVTDDDAIKALVA----KVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAK 111 +HL DVTD A+ A+V + G VD+L N G A G ++ ++ WD N N K Sbjct: 63 FASHLCDVTDSAAVGAMVEACVERFGRVDILVNNVGGSAKGGPVQLSEEDWDRQLNFNLK 122 Query: 112 AMFHTIRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVS 171 ++F T + VLP M + +G+IVN AS + + + Y ++KAA++ ++ VA ++ Sbjct: 123 SVFLTCKHVLPHMEKQGSGAIVNTASTSGIRWTGSAQVGYASAKAAIIQFSRVVAVEYAK 182 Query: 172 QGIRCNAICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALAL 231 + +R N + PG + +P + R++ Q G D + A AR P+G +G + A AL Sbjct: 183 KNVRVNTVVPGQMHTPMVEARLAGQ--RAGGDVDTLLAQRQARIPLGFMGDGRDTANAAL 240 Query: 232 YLASDESNFTTGSIHMIDGGWS 253 +LASDE+ F TG+ ++DGG S Sbjct: 241 FLASDEARFVTGTEIVVDGGMS 262 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 266 Length adjustment: 24 Effective length of query: 230 Effective length of database: 242 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory