Align FAA hydrolase family protein (characterized, see rationale)
to candidate RR42_RS05150 RR42_RS05150 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase
Query= uniprot:A0A2E7P912 (281 letters) >FitnessBrowser__Cup4G11:RR42_RS05150 Length = 312 Score = 173 bits (439), Expect = 4e-48 Identities = 101/251 (40%), Positives = 142/251 (56%), Gaps = 20/251 (7%) Query: 30 IKDVNGAVLDDASLDKIRKLDLESLPAVEGSPRIGACVGNIGKFICIGLNYADHAAESNL 89 + D+ G A+ K+ +D + AV P G+ + N+ DHA E Sbjct: 60 LADMAGRAAQLATSGKLAAVDAAATYAVPYQP---------GRIFGVASNFYDHADEMGT 110 Query: 90 PIPA----EPVVFNKWTSAVVGPNDDVKIPRGSKKTDWEVELGVVIGKGGSYIDEKDAMS 145 + A +P F K ++V+ V +P + K DWEVELGVVIG+ ++ +DA+S Sbjct: 111 KLAARSESQPYAFMKAETSVIPTGATVLMPPETAKLDWEVELGVVIGQRCRHVPVEDALS 170 Query: 146 HVAGYCVVNDVSEREYQIERG----GTWDKGKGCDTFGPIGPWLVTRDEVADPQKLGMWL 201 +AGY V ND+S R+ W +GK DTFGP+GPW+V +ADPQ L M L Sbjct: 171 VIAGYTVFNDISARDLNRRTDYPFTHDWFRGKSFDTFGPMGPWVVPAGCIADPQNLRMSL 230 Query: 202 EVDGKRYQNGNTSTMIFGVAHIVSYLSRFMSLQPGDVISTGTPPGVGMGVKPEAVYLRAG 261 V+G+ Q+GNTS MIF VA ++YLSR ++LQPGD+I+TGTP GVGMG V+L+ G Sbjct: 231 TVNGETMQDGNTSQMIFSVAEQIAYLSRILTLQPGDLIATGTPDGVGMG---RGVFLKPG 287 Query: 262 QTMRLGIDGLG 272 M I+G+G Sbjct: 288 DNMVAWIEGIG 298 Lambda K H 0.316 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 312 Length adjustment: 26 Effective length of query: 255 Effective length of database: 286 Effective search space: 72930 Effective search space used: 72930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory