Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate RR42_RS18590 RR42_RS18590 hypothetical protein
Query= reanno::WCS417:GFF4321 (386 letters) >FitnessBrowser__Cup4G11:RR42_RS18590 Length = 359 Score = 322 bits (826), Expect = 8e-93 Identities = 171/365 (46%), Positives = 241/365 (66%), Gaps = 6/365 (1%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 MA++++R + K +G+ ++ +++ I +G+F +LVGPSGCGKSTL+ IAGLE IT G Sbjct: 1 MASVQIRGIQKYFGS--TQVIRGVDIDIADGQFTVLVGPSGCGKSTLLRMIAGLEEITTG 58 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 I IG++ V+ + PK+RDIAMVFQ+YALYP M+V +N+ F LK+ K + +I +VA+ + Sbjct: 59 EIAIGNRVVNRLPPKERDIAMVFQNYALYPHMTVYDNMAFSLKLAKGDKEEIKRKVAKAS 118 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 +L ++ LL R P QLSGGQ+QRVAMGRA+ R P+++LFDEPLSNLDAKLRV+MR E+K Sbjct: 119 AILGLDSLLERYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVQMRAEIKE 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPP 240 +HQRL+TT+VYVTHDQIEAMT+ D++ VM+DG ++Q G P +Y++P N FVA FIGSP Sbjct: 179 LHQRLRTTSVYVTHDQIEAMTMADQIVVMRDGRVEQRGKPLALYDHPDNLFVAGFIGSPA 238 Query: 241 MNFVPLRLQRKDGRLVALLDSGQARCELALNTTEAGLEDRDVILGLRPEQIMLAAGEGDS 300 MNFVP L+R G G A AG + + VI G+RPE + L G Sbjct: 239 MNFVPGVLRRSGGDAAVEFPDGTRLPAPARFDATAGTDGQRVIYGVRPEHLTL----GMP 294 Query: 301 ASSIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAPDVAPQVGETLTLQFDPSKVLLFDAN 360 ++ V V EPTG +T ++ + + + G+ L L D LFDA+ Sbjct: 295 GQGLQTRVSVVEPTGANTEIYSRFCEAEFISIFRERHDFAAGDILNLVPDHQHTHLFDAD 354 Query: 361 TGERL 365 +G+ L Sbjct: 355 SGQTL 359 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 359 Length adjustment: 30 Effective length of query: 356 Effective length of database: 329 Effective search space: 117124 Effective search space used: 117124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory