Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate RR42_RS19270 RR42_RS19270 short-chain dehydrogenase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >FitnessBrowser__Cup4G11:RR42_RS19270 Length = 262 Score = 143 bits (361), Expect = 3e-39 Identities = 101/248 (40%), Positives = 130/248 (52%), Gaps = 11/248 (4%) Query: 16 LKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKACFERVD 75 L+ K +++GG + IGAG+ F G V DI + + L G +A F D Sbjct: 4 LRDKVAIISGGATLIGAGVASAFVEAGTRVAILDIDASGGERAAAAL---GERALFVHTD 60 Query: 76 LTDVASLQAVIARLIKGAGGFDILVNNAAN--DDRHAIDEITEAYWDERLSVNLKHIFFC 133 +TD A + A +AR+ + GG D LVN A DD + W L VN+ Sbjct: 61 ITDDAQVAAAVARVSQHFGGVDYLVNLACTYLDDGF---KSARRDWLAALDVNVVSGVML 117 Query: 134 AQAVVPAMRARGGGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRAT 193 AQAV PAMRARGGGAIVN SIS ++G + LY KAAI LTRS+A DL DGIR Sbjct: 118 AQAVHPAMRARGGGAIVNFTSISANVGQTGRWLYPASKAAIRQLTRSMAMDLAPDGIRVN 177 Query: 194 CVIPGNV--RTPRQLKWYSPEGEAEIVAAQCLDGRLA-PEDVAAMVLFLASDDARLVTGH 250 V PG R ++ + E + A L GR+ P++VA +VLFL SD A VTG Sbjct: 178 AVSPGWTWCRLMDEVSGGNRERTDRVAADFHLLGRVGEPDEVAQVVLFLCSDHASFVTGA 237 Query: 251 SYFVDAGW 258 Y VD G+ Sbjct: 238 DYAVDGGY 245 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 262 Length adjustment: 25 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory