Align Sorbitol dehydrogenase; SDH; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.56; EC 1.1.1.9 (characterized)
to candidate RR42_RS22860 RR42_RS22860 l-threonine 3-dehydrogenase
Query= SwissProt::Q9FJ95 (364 letters) >FitnessBrowser__Cup4G11:RR42_RS22860 Length = 351 Score = 166 bits (419), Expect = 1e-45 Identities = 102/304 (33%), Positives = 159/304 (52%), Gaps = 11/304 (3%) Query: 37 PSVGPHDVRVRMKAVGICGSDVHYLKTMRCADFVVKEPMVIGHECAGIIEEVGEEVKHLV 96 P VG +DV +R++ ICG+D+H K A + PM +GHE G I +G+EV+ L Sbjct: 21 PEVGHNDVMIRIRQTAICGTDIHIWKWDEWAQNTIPVPMQVGHEYVGEIVAIGQEVRGLA 80 Query: 97 VGDRVALEPGISCWRCNLCREGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPENV 156 +GDRV+ E I+C C CR GR +LC G+ A +V PA F++P+++ Sbjct: 81 IGDRVSGEGHITCGFCRNCRAGRRHLCRNSVGVGVNRA-GAFAEYLVIPAFNAFRIPDDI 139 Query: 157 SLEEGAMCEPLSVGVHACRRAEVGPETNVLVMGAGPIGLVTMLAARAFSVPRIVIVDVDE 216 E A+ +P H + E +VL+ GAGPIG++ AR +VI DV+E Sbjct: 140 PDEIAAIFDPFGNATHTALSFNLVGE-DVLITGAGPIGIMAAAIARHVGARNVVITDVNE 198 Query: 217 NRLAVAKQLGADEIVQVT-TNLEDVGSEVEQIQKAMGSNIDVTFDCAGFNKTMSTALAAT 275 RLA+A+++GA V V NL+DV +E+ M DV + +G +T L Sbjct: 199 YRLALARKMGATRAVNVQHENLKDVAAELH-----MTEGFDVGMEMSGVPTAFATMLEHM 253 Query: 276 RCGGKVCLVGMGHGIMTVPLTPAAAREVDVVGVFRYK--NTWPLCLEFLTSGKIDVKPLI 333 GGK+ ++G+ M + + +++ G++ + TW + L SG +D+ P+I Sbjct: 254 NHGGKIAMLGIPPSKMAIDWNQVIFKGLEIKGIYGREMFETWYKMVAMLQSG-LDLTPMI 312 Query: 334 THRF 337 THRF Sbjct: 313 THRF 316 Lambda K H 0.321 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 351 Length adjustment: 29 Effective length of query: 335 Effective length of database: 322 Effective search space: 107870 Effective search space used: 107870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory