Align ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized)
to candidate RR42_RS32895 RR42_RS32895 ABC transporter permease
Query= TCDB::Q9WXW7 (317 letters) >FitnessBrowser__Cup4G11:RR42_RS32895 Length = 318 Score = 161 bits (407), Expect = 2e-44 Identities = 91/295 (30%), Positives = 164/295 (55%), Gaps = 2/295 (0%) Query: 14 GPLVALVSLAVFTAILNPRFLTAFNLQALGRQIAIFGLLAIGETFVIISGGGAIDLSPGS 73 G + L+ L++ ++ P FL+ NL +G Q I L+A+ T +I++ G +DLS G+ Sbjct: 20 GSVWVLLLLSLGFSVTGPGFLSVENLLNIGAQSTILLLIALPMTLIIMTEG--LDLSMGA 77 Query: 74 MVALTGVMVAWLMTHGVPVWISVILILLFSIGAGAWHGLFVTKLRVPAFIITLGTLTIAR 133 ++ L GV++A +M + +++ LL + G +G V+ L +P F+ TLGTL +A+ Sbjct: 78 VLTLCGVVLAMVMVATESLPLALGAALLTGLAFGLLNGALVSWLEIPPFVATLGTLGVAQ 137 Query: 134 GMAAVITKGWPIIGLPSSFLKIGQGEFLKIPIPVWILLAVALVADFFLRKTVYGKHLRAS 193 G+A V T G + G+ + I G+ L +P+P+WI + + L T +G ++ A Sbjct: 138 GLALVATDGQSVTGIGEAIPLIYAGQLLGVPLPIWIAAVFYGLFHWLLYHTRFGAYVFAL 197 Query: 194 GGNEVAARFSGVNVDRVRMIAFMVSGFLAGVVGIIIAARLSQGQPGVGSMYELYAIASTV 253 GGN A +FSGV ++ + + + G +AGV +++ AR++ G P E AIA+ Sbjct: 198 GGNREALKFSGVRINVYLIAVYALGGLMAGVAALLLTARMNAGHPTAAIGLEFDAIAAVA 257 Query: 254 IGGTSLTGGEGSVLGAIVGASIISLLWNALVLLNVSTYWHNVVIGIVIVVAVTLD 308 +GGT+ G G + G ++G + +L N L L+ V + IG++++V + ++ Sbjct: 258 VGGTTFDRGNGWLPGTVLGVLAVGVLRNGLNLVGVPSSVQVAAIGLLVLVVLLIE 312 Lambda K H 0.328 0.143 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 26 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 318 Length adjustment: 27 Effective length of query: 290 Effective length of database: 291 Effective search space: 84390 Effective search space used: 84390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory