Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate RR42_RS26360 RR42_RS26360 alcohol dehydrogenase
Query= BRENDA::F2YCN5 (340 letters) >FitnessBrowser__Cup4G11:RR42_RS26360 Length = 325 Score = 124 bits (310), Expect = 4e-33 Identities = 93/296 (31%), Positives = 144/296 (48%), Gaps = 23/296 (7%) Query: 43 DDASIKTIHRAIDLGINIIDTAPAYGRGHAEEVVGKAIK--GQRDNLIIATKVGLDWTLT 100 + AS I +AI+ GIN DTA Y G +EE+VG+A+K RD+++IATKV Sbjct: 37 EPASRPLIRQAIEAGINFFDTANVYSDGTSEEIVGRALKDFASRDDVVIATKVHGRMRPG 96 Query: 101 PDQSMRRNSSASRIKKEIEDSLRRLGTDYIDLYQVHWPDPLVPIEETATILEALRKEGKI 160 P+ + S I EI++SLRRLGTDY+DLYQ+H DP PIEET L + K GK Sbjct: 97 PNGA---GLSRRAILAEIDNSLRRLGTDYVDLYQIHRWDPHTPIEETLEALHDVVKAGKA 153 Query: 161 RSIGVSNYSVQQMDE------FKKYAELAVSQSPYNLFEREIDKDILPYAKKNDLVVLGY 214 R IG S+ Q + + + A Q NL RE ++++LP + V+ + Sbjct: 154 RYIGASSMYAWQFSKAIYTSRLHGWTQFASMQDHVNLLNREEEREMLPLCAAEGIAVMPW 213 Query: 215 GALCRGLLSGRMTADRAFTGDDLRKTDPKFQKPRFEHYLAA----VEELKKLAKEHYNKS 270 L RG L+ R + R+ F K + A+ VE++ +A+ Sbjct: 214 SPLARGRLT------RPWHAGSAREESDTFGKTLYRDTEASDRVVVEQVHAIAQAR-GVP 266 Query: 271 VLALAIRWMLEQGP-TLALWGACKPEQIDGIDEVFGWQISDEDLKQIDAILAKNIP 325 +A+ W+ ++ T + GA KP I+ ++ E++ ++A + P Sbjct: 267 PAQVALAWLSQKREITSPIIGASKPHHIEDAVAALSLGLTAEEIAALEAPYVPHAP 322 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 325 Length adjustment: 28 Effective length of query: 312 Effective length of database: 297 Effective search space: 92664 Effective search space used: 92664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory