GapMind for catabolism of small carbon sources

 

Protein 3606962 in Dinoroseobacter shibae DFL-12

Annotation: FitnessBrowser__Dino:3606962

Length: 357 amino acids

Source: Dino in FitnessBrowser

Candidate for 22 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-fructose catabolism frcC hi Fructose import permease protein FrcC (characterized) 71% 99% 493.8 Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR 36% 189.1
D-mannose catabolism frcC hi Fructose import permease protein FrcC (characterized) 71% 99% 493.8 Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR 36% 189.1
D-ribose catabolism frcC hi Fructose import permease protein FrcC (characterized) 71% 99% 493.8 Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR 36% 189.1
sucrose catabolism frcC hi Fructose import permease protein FrcC (characterized) 71% 99% 493.8 Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR 36% 189.1
xylitol catabolism PS417_12060 lo ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale) 37% 91% 197.2 Fructose import permease protein FrcC 71% 493.8
D-cellobiose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 96% 189.1 Fructose import permease protein FrcC 71% 493.8
D-glucose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 96% 189.1 Fructose import permease protein FrcC 71% 493.8
lactose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 96% 189.1 Fructose import permease protein FrcC 71% 493.8
D-maltose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 96% 189.1 Fructose import permease protein FrcC 71% 493.8
sucrose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 96% 189.1 Fructose import permease protein FrcC 71% 493.8
trehalose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 96% 189.1 Fructose import permease protein FrcC 71% 493.8
D-xylose catabolism xylH lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 96% 189.1 Fructose import permease protein FrcC 71% 493.8
L-fucose catabolism HSERO_RS05255 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 37% 87% 188.7 Fructose import permease protein FrcC 71% 493.8
D-ribose catabolism rbsC lo Ribose import permease protein RbsC (characterized) 35% 97% 183 Fructose import permease protein FrcC 71% 493.8
D-mannose catabolism HSERO_RS03645 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 35% 90% 175.6 Fructose import permease protein FrcC 71% 493.8
myo-inositol catabolism PS417_11895 lo Inositol transport system permease protein (characterized) 34% 90% 167.9 Fructose import permease protein FrcC 71% 493.8
D-galactose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 32% 98% 161 Fructose import permease protein FrcC 71% 493.8
L-arabinose catabolism araZsh lo Inner-membrane translocator (characterized, see rationale) 30% 96% 137.5 Fructose import permease protein FrcC 71% 493.8
L-rhamnose catabolism rhaQ lo RhaQ (characterized, see rationale) 31% 90% 136 Fructose import permease protein FrcC 71% 493.8
D-fructose catabolism fruF lo Fructose import permease protein FruF (characterized) 32% 76% 125.9 Fructose import permease protein FrcC 71% 493.8
sucrose catabolism fruF lo Fructose import permease protein FruF (characterized) 32% 76% 125.9 Fructose import permease protein FrcC 71% 493.8
D-galactose catabolism ytfT lo Galactofuranose transporter permease protein YtfT (characterized) 32% 93% 120.6 Fructose import permease protein FrcC 71% 493.8

Sequence Analysis Tools

View 3606962 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTEPRPQGQDYESALKDSAAAVAEFDHGPQGFTRKFQHALHQTPALVPLIVLVAAIAVFG
LLLGSKFFSPFALTLILQQVQIVGIVAAAQSLVILTAGIDLSVGAIMVMSSVVMGQFTFR
YGLPVEVAVACGLLCGTLLGFINGWLVAKVKLPPFIVTLGMWQIVLAANFLYSRNETIRS
QDIRDQAPLLQFFGTTLEIGGARLTYGVIFMVLLVIVLAYALRHTAWGRHVYAVGDDPEA
AELSGVQVSRTLISVYMLSGLICAFAGWALIGRIGSVSPTSGQLANIESITAVVIGGISL
FGGRGSILGAFFGALIVGVFTLGLRLLGADAQWTFLLIGLLIIAAVAVDQWIRKVSV

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory