Protein 3607124 in Dinoroseobacter shibae DFL-12
Annotation: FitnessBrowser__Dino:3607124
Length: 338 amino acids
Source: Dino in FitnessBrowser
Candidate for 39 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
xylitol catabolism | Dshi_0546 | hi | ABC transporter for Xylitol, ATPase component (characterized) | 100% | 100% | 666.8 | ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component | 54% | 361.3 |
D-mannitol catabolism | mtlK | med | ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) | 54% | 98% | 361.3 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-sorbitol (glucitol) catabolism | mtlK | med | MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) | 53% | 98% | 359 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
N-acetyl-D-glucosamine catabolism | SMc02869 | med | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 54% | 100% | 350.1 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-glucosamine (chitosamine) catabolism | SMc02869 | med | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 54% | 100% | 350.1 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
lactose catabolism | lacK | med | LacK, component of Lactose porter (characterized) | 50% | 100% | 331.6 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-maltose catabolism | malK | med | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 50% | 97% | 318.9 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-maltose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 50% | 99% | 318.5 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
sucrose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 50% | 99% | 318.5 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
trehalose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 50% | 99% | 318.5 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
L-fucose catabolism | SM_b21106 | med | ABC transporter for L-Fucose, ATPase component (characterized) | 49% | 99% | 313.9 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
trehalose catabolism | malK | med | MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) | 48% | 100% | 308.1 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-maltose catabolism | malK_Sm | med | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 47% | 98% | 307.4 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
L-arabinose catabolism | xacK | med | Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) | 47% | 96% | 307 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-cellobiose catabolism | msiK | med | MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) | 49% | 95% | 306.6 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-maltose catabolism | malK_Aa | med | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 49% | 94% | 300.8 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-maltose catabolism | malK_Bb | med | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 48% | 98% | 300.1 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-xylose catabolism | gtsD | med | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 45% | 93% | 298.9 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-cellobiose catabolism | SMc04256 | med | ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) | 46% | 98% | 297.7 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
L-arabinose catabolism | xacJ | med | Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) | 48% | 96% | 297 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-glucosamine (chitosamine) catabolism | SM_b21216 | med | ABC transporter for D-Glucosamine, ATPase component (characterized) | 46% | 99% | 295 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-galactose catabolism | PfGW456L13_1897 | med | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 44% | 93% | 292 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-maltose catabolism | musK | med | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 47% | 95% | 291.2 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
xylitol catabolism | HSERO_RS17020 | med | ABC-type sugar transport system, ATPase component protein (characterized, see rationale) | 45% | 89% | 283.1 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
trehalose catabolism | treV | med | TreV, component of Trehalose porter (characterized) | 41% | 97% | 248.4 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
L-arginine catabolism | artP | med | Arginine transport ATP-binding protein ArtP; EC 7.4.2.- (characterized) | 42% | 92% | 154.1 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-cellobiose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 96% | 196.4 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-galactose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 96% | 196.4 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-glucose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 96% | 196.4 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
lactose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 96% | 196.4 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-maltose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 96% | 196.4 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-mannose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 96% | 196.4 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
sucrose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 96% | 196.4 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
trehalose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 35% | 96% | 196.4 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
glycerol catabolism | glpS | lo | ABC transporter for Glycerol, ATPase component 1 (characterized) | 32% | 95% | 191 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
L-proline catabolism | proV | lo | glycine betaine/l-proline transport atp-binding protein prov (characterized) | 38% | 62% | 172.6 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-alanine catabolism | Pf6N2E2_5405 | lo | ABC transporter for D-Alanine, ATPase component (characterized) | 37% | 94% | 154.5 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
D-glucosamine (chitosamine) catabolism | AO353_21725 | lo | ABC transporter for D-glucosamine, ATPase component (characterized) | 38% | 94% | 154.1 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
L-tryptophan catabolism | ecfA1 | lo | Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) | 37% | 77% | 129 | ABC transporter for Xylitol, ATPase component | 100% | 666.8 |
Sequence Analysis Tools
View 3607124 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MAGIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRI
EIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARV
LQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLH
KQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMN
VFSSDVGLQDISLDASAAFVGCRPEHIEIVPDGDGHIAATVHVKERLGGESLLYLGLKGG
GQIVARVGGDDETKVGAAVSLRFSRHRLHQFDEAGRAI
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory