Annotation: FitnessBrowser__Dino:3607475
Length: 324 amino acids
Source: Dino in FitnessBrowser
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
---|---|---|---|---|---|---|---|---|---|
D-serine catabolism | dsdA | med | D-Serine ammonia-lyase (EC 4.3.1.18) (characterized) | 47% | 99% | 305.1 | serine racemase (EC 5.1.1.18) | 82% | 537.3 |
L-serine catabolism | sdaB | med | serine racemase (EC 5.1.1.18) (characterized) | 49% | 94% | 293.1 | serine racemase (EC 5.1.1.18) | 82% | 537.3 |
L-threonine catabolism | tdcB | lo | threonine ammonia-lyase; EC 4.3.1.19 (characterized) | 38% | 99% | 207.6 | serine racemase (EC 5.1.1.18) | 82% | 537.3 |
View 3607475 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
MKDTIDPAVIPTYDDVVAAHERIKPHIHRTPVLTSSYFNDLVGAELFFKCENFQKAGAFK VRGACNAVFGLSDALAERGVATHSSGNHALSLSYAAGRRGIPCNVVMPRTAPEAKKAAVR GYGGIITECEPSTTSREAVFAEVQERTGAEFVHPYNDPRVVAGQGTCSREFMEQTDGLDM MIAPIGGGGMISGCCLTLSNIAPEVQIIAAEPEQADDAYRSFKAGHIIADDAPVTIADGL KVPLKDLTWHFVSNHVSDILTASEQEIIDAMKLTWQRMKIVMEPSCAVPLATILKNKDKF AGKRVGVIVTGGNVDLDKLPWITG
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory