Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate 3608036 Dshi_1443 TRAP transporter solute receptor, TAXI family (RefSeq)
Query= reanno::psRCH2:GFF85 (317 letters) >FitnessBrowser__Dino:3608036 Length = 322 Score = 169 bits (427), Expect = 1e-46 Identities = 103/316 (32%), Positives = 159/316 (50%), Gaps = 6/316 (1%) Query: 8 GLLAAAAAFTASTAAVAAPTFINILTGGTSGVYYPIGVALSQQYNKI---DGAKTSVQAT 64 G L AAA + A TFI I TGG +GVYYP G A+ + N+ G + V++T Sbjct: 7 GALVAAATALGGGSVAAQDTFIAIGTGGVTGVYYPTGGAICRLVNRNRSEHGIRCGVEST 66 Query: 65 KASVENLNLLQAGRGELAFSLGDSVEDAWNGVEDAGFKAPLKRLRAIAGTYNNYIQIVAS 124 SV N+N ++ G E + D A+NG + P + LRAI + +VA Sbjct: 67 GGSVFNINAIRGGELEFGVAQSDWQFHAFNGTSRFEEQGPFEDLRAIFSVHPEPFTVVAR 126 Query: 125 AESGIKTLDDLKGKRISVGAPKSGTELNARAIFKAAGLDYKDMGRVEFLPYAESVELIKN 184 A++GI+T +DLKGKR++VG P SG + +A G D L AE + + + Sbjct: 127 ADAGIETFEDLKGKRVNVGNPGSGQRGTMEVLMEAMGWTMDDFAVASELQAAEQSQALCD 186 Query: 185 RQLDATLQSSGLGMAAIRDLASTMPVTFVEIPAEVVEKIESD--AYLAGVIPAGTYDGQD 242 +DA + + G +I++ + V + + V+++ +D Y IP G Y G D Sbjct: 187 NNIDAMIYTVGHPSGSIQEATTACDSVLVTVANDAVDQLVADNSFYRTATIPGGMYRGTD 246 Query: 243 ADVPTVAITNILVTHEKVSDEVAYQMTKLMFDNLAALGNAHSAAKDIKL-ENATKNLPIP 301 D T + V+ V +EV Y++ K +FDN+ H A ++ E A L P Sbjct: 247 EDTMTFGVGATFVSSMAVPEEVVYEVVKAVFDNIDQFKGLHPAFANLDAKEMANDGLSAP 306 Query: 302 LHPGAERFYKEAGVLK 317 LHPGAER+++EAG+++ Sbjct: 307 LHPGAERYFREAGLIE 322 Lambda K H 0.314 0.131 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 322 Length adjustment: 28 Effective length of query: 289 Effective length of database: 294 Effective search space: 84966 Effective search space used: 84966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory