GapMind for catabolism of small carbon sources

 

Alignments for a candidate for ackA in Dinoroseobacter shibae DFL-12

Align Acetate kinase; EC 2.7.2.1; Acetokinase (uncharacterized)
to candidate 3608653 Dshi_5006 hypothetical protein (NCBI)

Query= curated2:Q6N143
         (398 letters)



>FitnessBrowser__Dino:3608653
          Length = 385

 Score =  283 bits (723), Expect = 8e-81
 Identities = 172/394 (43%), Positives = 230/394 (58%), Gaps = 20/394 (5%)

Query: 2   SDVLLVLNAGSSSIKFALYEAHTEPTADHLICEGGIGSLGHRPHFKVVNSDGSTRYDTYL 61
           SD++LVLNAGSSS+KFAL+   T   A+HL   G   S+G     K+    G+      L
Sbjct: 7   SDLILVLNAGSSSLKFALF---TPALAEHLT--GQAESIGGPGRLKI----GARSASCDL 57

Query: 62  PEGTSHDDAMAVLIGWIETT-FPEHRLSAVGHRVVHGGALFDGPVDVTPEVIAQLRAFDR 120
           P+   H  A+A ++  + T       L AV HRVVHGG     PV +TP   +++ A   
Sbjct: 58  PD---HGAALAAILEALATRGITASHLKAVAHRVVHGGVRLTAPVRITPATRSEIAACSA 114

Query: 121 LAPLHQPHNVSAIEALAKLHPSLPQIACFDTAFHHRLPEVATAFALPRELTEQGVRRYGF 180
           LAPLH PHN++AI+ +  L P +PQ A FDTAFH   PEVA  + LP      G+RRYGF
Sbjct: 115 LAPLHNPHNLAAIDRITALMPDVPQCASFDTAFHASNPEVALRYGLPDTAETAGLRRYGF 174

Query: 181 HGLSYEYIAGRLPDVAGQAVADGRVVVAHLGAGASMCAMLRCRSIATTMGFTALDGLMMG 240
           HG SY  +      V G A+ D R++  HLG+GAS+CA+   RS+ATTMG++ L+GL M 
Sbjct: 175 HGQSYAAMVDSWSRVTGAALPD-RLLAFHLGSGASICAIRDGRSVATTMGYSPLEGLTMA 233

Query: 241 SRCGELDPGVVLYLLEEKSMT-AREIEDLLYRESGLLGVSGISDDMRTLLASDDPHACEA 299
           +R G +D   VL L E+  +  AR I   L  ESGL G+SG   DMRTL+ASD P A  A
Sbjct: 234 TRSGSIDGNAVLKLAEDHGIARARRI---LNNESGLAGLSGGLSDMRTLMASDRPEAGFA 290

Query: 300 IELFVYRIARELGSLAAALGGLDALVFTGGIGEHASEIRRRVCEQAAWLGVTLDPDANAS 359
           ++ FVY   R   SL A LGG + + FTGGIGE+A+EIR R+     W+G  +DP+ANA 
Sbjct: 291 VDHFVYWAVRHASSLLAPLGGTETIAFTGGIGENAAEIRARIVAGLHWIGAEIDPEANA- 349

Query: 360 LSGAGRISAPDSKVSAWAIPTDEDLMIARHVWRL 393
             G   + +  S    + IP +E+ M+A    R+
Sbjct: 350 -EGQTALHSAASATGIYIIPAEEERMLAADALRV 382


Lambda     K      H
   0.321    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 478
Number of extensions: 26
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 398
Length of database: 385
Length adjustment: 31
Effective length of query: 367
Effective length of database: 354
Effective search space:   129918
Effective search space used:   129918
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

Align candidate 3608653 Dshi_5006 (hypothetical protein (NCBI))
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))

Software error:

../bin/blast/fastacmd -i /tmp/list.18650.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.18650.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.