Align BadK (characterized)
to candidate 3607639 Dshi_1048 Enoyl-CoA hydratase/isomerase (RefSeq)
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__Dino:3607639 Length = 265 Score = 142 bits (357), Expect = 9e-39 Identities = 95/258 (36%), Positives = 132/258 (51%), Gaps = 3/258 (1%) Query: 1 MSSNPILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRA 60 ++ +L + +G V ITLN PD LNA+ A+ LG + A D ++ RA Sbjct: 5 LAEGRLLLDREGPVARITLNNPDRLNAMRLAMWQGLGDLAVELAASDARVVVLRGAGDRA 64 Query: 61 FAAGADIAS---MAAWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALAC 117 F AGADI+ + A + + R E + + PVLAA+ G GGG E+A+ C Sbjct: 65 FCAGADISEFPQVRATPEGVAAYNRTVARALEGLAALPMPVLAAIRGHCIGGGLEIAVRC 124 Query: 118 DIVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLV 177 D+ +A +A+ A KLGL GA L R G A A ++ +A+P++A A+R+GLV Sbjct: 125 DLRLASETARIAFTPAKLGLAIGADEVAALARIAGPAAAAELLYTAQPVDAARAERWGLV 184 Query: 178 SRVVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFAS 237 +R V +D L DE ALA TIAA + L A+K L A + F S Sbjct: 185 NRRVPEDMLMDEADALARTIAANAPLTLRAVKAGLAAFARPGDAAAASHADALVKTCFDS 244 Query: 238 ADAREGIQAFLEKRAPCF 255 AD REG +AF EKR P F Sbjct: 245 ADYREGQRAFAEKRRPEF 262 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 265 Length adjustment: 25 Effective length of query: 233 Effective length of database: 240 Effective search space: 55920 Effective search space used: 55920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory