Align 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.178 (characterized)
to candidate 3608297 Dshi_1700 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= SwissProt::O18404 (255 letters) >FitnessBrowser__Dino:3608297 Length = 251 Score = 242 bits (617), Expect = 6e-69 Identities = 129/246 (52%), Positives = 166/246 (67%), Gaps = 4/246 (1%) Query: 8 LVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSA 67 LVTGGASGLG AT L +GA+V + D +++G+++A E G +F DVT + A Sbjct: 9 LVTGGASGLGEATVRHLRAKGAAVAVLDRDATRGHQLAAESG--ALFFETDVTDDVSAEA 66 Query: 68 ALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSA 127 ++ A GR+ V CAG AT+ KT + H L+ FQR I+IN VGTFN+ RL+A Sbjct: 67 SVTAAATALGRITACVTCAGVATSAKTLG--REGPHGLDAFQRTIDINLVGTFNIARLAA 124 Query: 128 GLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRI 187 M N P+ DG RGVIV TAS+AAFDGQ GQAAY+ASKA V G++LP+ARDL+ +GIR+ Sbjct: 125 AEMARNAPDADGARGVIVTTASIAAFDGQKGQAAYAASKAGVTGLSLPMARDLAREGIRV 184 Query: 188 CTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYENPLLNGEVIRI 247 +IAPG+F TPML L E++ LA + FP+RLG+P EYA LV I E LNG IR+ Sbjct: 185 MSIAPGIFRTPMLIGLGEEIMEALAADVTFPKRLGDPVEYARLVAFILECGYLNGTTIRL 244 Query: 248 DGALRM 253 DGALRM Sbjct: 245 DGALRM 250 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 251 Length adjustment: 24 Effective length of query: 231 Effective length of database: 227 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory