Align FcbT1, component of Tripartite 4-chlorobenzoate symporter (also binds and may transport 4-bromo-, 4-iodo-, and 4-fluorobenzoate and with a lower affinity, 3-chlorobenzoate, 2-chlorobenzoate, 4-hydroxybenzoate, 3-hydroxybenzoate, and benzoate) (characterized)
to candidate 3607634 Dshi_1043 TRAP dicarboxylate transporter- DctP subunit (RefSeq)
Query= TCDB::Q9RBR1 (326 letters) >FitnessBrowser__Dino:3607634 Length = 331 Score = 142 bits (357), Expect = 1e-38 Identities = 102/312 (32%), Positives = 147/312 (47%), Gaps = 8/312 (2%) Query: 1 MRIHRRQFSIAAAASVASAALPVRAQELVLRAVSAFPEKTSQSIHFEKFIERVNSTGKGV 60 M +H R + AA +A+ AL +QE L V + P + F+E VN+ G G+ Sbjct: 1 MTLHTRLLAAGAALLLAAPAL---SQEARLSVVYSLPATNDLMQSYFAFVEDVNANGAGI 57 Query: 61 LRINYVGGPRAIPTFEVGNAVKSGVVDIANCHGGYYANLFPEADALKLMQVTPQELRRSG 120 L+I+ GG +P E NAV G++D+ GYY PE L V +LR +G Sbjct: 58 LQIDLRGGTEILPRNEQMNAVSRGIIDLYFGPAGYYQRQVPELTPLDAAAVPADKLRAAG 117 Query: 121 GFDAINRIWNAKGNMQYL-AMIYGYS-PFHLFLNKKISKPS--ELAGMKIRISPLYRDFL 176 DAI+ + + +L AM GY+ F+ KI + +G+KIR Y Sbjct: 118 LHDAIDAGTRERAGVAFLGAMGTGYNFQFYTITEPKIDDDGTMDFSGLKIRGGASYDPMY 177 Query: 177 SALGVQVVNVAPGEIYTALERGVVEGYGWPIYSIFDLGWHEKTKYRVEPGFYNTETSIIM 236 ALG+ V+V G+IYTALERG+VEG G+ + GW + +YR+ P + T I Sbjct: 178 QALGIARVDVPAGDIYTALERGLVEGIGFTTIGVSSGGWQDFLRYRIFPTWRQGNTIIAA 237 Query: 237 NLDSYKRLTSAQRAVLDPALAYAEGLNED-YKTINAREEKKQADAGIQVIRFEGEEGREF 295 N + LT QRA L + E L D K + A + A+AG+Q + EG E Sbjct: 238 NAAKFDGLTEEQRAYLMEMIQKHEMLAYDAAKALEAVDTAALAEAGVQDVVLEGAGAAEV 297 Query: 296 VRRAYDEGWKGI 307 D W + Sbjct: 298 TAAFQDTFWVNV 309 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 331 Length adjustment: 28 Effective length of query: 298 Effective length of database: 303 Effective search space: 90294 Effective search space used: 90294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory