Align Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized)
to candidate 3609950 Dshi_3331 acetyl-CoA acetyltransferase (RefSeq)
Query= SwissProt::Q8VPF1 (401 letters) >FitnessBrowser__Dino:3609950 Length = 394 Score = 353 bits (907), Expect = e-102 Identities = 201/399 (50%), Positives = 264/399 (66%), Gaps = 9/399 (2%) Query: 1 MSREVYICDAVRTPIGRFGGSLAAVRADDLAAVPVKALVERNPQVDWSQLDEVYLGCANQ 60 + +++ I D RT IG FGGSLA L A KA +ER+ V+ +Q+ V G Sbjct: 3 LDQDIVILDGARTAIGTFGGSLAGTAPITLGATVAKAALERSG-VEGAQIGHVVFGHVIN 61 Query: 61 AGEDNRNVARMALLLAGLPDSVPGVTLNRLCASGMDAVGTAFRAIASGEAELVIAGGVES 120 + ++R+A + AG+PD+ P + +NRLC SG A+ + +++ G+A+ +AGG ES Sbjct: 62 TEPRDMYLSRVAAMEAGIPDTTPAMNVNRLCGSGAQALVSVIQSLMLGDAQFGLAGGAES 121 Query: 121 MSRAPYVMGKADSAFGRGQKIEDTTIGWRFINPLMKAQYGVDAMPETADNVADDYKVSRA 180 MSR+PY M A GQK+ D T + L +G M TA+NVA ++ + RA Sbjct: 122 MSRSPYAMPVARW----GQKMGDATAMDMMLGAL-NCPFGTGHMGVTAENVAAEHGIGRA 176 Query: 181 DQDAFALRSQQLAGRAQAAGYFAEEIVPVVIKGKKGETVVDADEHLRPDTTLEALAKLKP 240 DQDAFAL SQ A RAQ AG+F +IVPV +K K+ DEH +P TT EALA L+ Sbjct: 177 DQDAFALESQARAARAQEAGHFNSQIVPVPVKVKRDMVDFVRDEHPKP-TTAEALAGLRT 235 Query: 241 VNGPDKTVTAGNASGVNDGSVALILASAEAVKKHGLKARAKVLGMASAGVAPRVMGIGPV 300 V D TVTAGNASG+NDG+ AL+LA A A + GLK RA++LG A AGV P VMGIGPV Sbjct: 236 VFQKDGTVTAGNASGINDGAAALVLARASAAESAGLKPRARILGYAHAGVRPEVMGIGPV 295 Query: 301 PAVRKLLERLNLSVADFDVIELNEAFAAQGLAVTRELGIADDDARVNPNGGAIALGHPLG 360 PAV+ LL + +LSV+DFDVIE NEAFAAQ LAV + LG+ D A+VNPNGGAIALGHP+G Sbjct: 296 PAVQALLAKTDLSVSDFDVIESNEAFAAQALAVNKGLGL--DPAKVNPNGGAIALGHPVG 353 Query: 361 ASGARLVLTAVHQLEKSGGQRGLCTMCVGVGQGVALAVE 399 A+GA + L A+++LE+ GG+R L TMC+G GQG+ALA E Sbjct: 354 ATGAIIALKALYELERIGGKRALVTMCIGGGQGIALAFE 392 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 394 Length adjustment: 31 Effective length of query: 370 Effective length of database: 363 Effective search space: 134310 Effective search space used: 134310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory