GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pcaF in Dinoroseobacter shibae DFL-12

Align Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized)
to candidate 3609950 Dshi_3331 acetyl-CoA acetyltransferase (RefSeq)

Query= SwissProt::Q8VPF1
         (401 letters)



>lcl|FitnessBrowser__Dino:3609950 Dshi_3331 acetyl-CoA
           acetyltransferase (RefSeq)
          Length = 394

 Score =  353 bits (907), Expect = e-102
 Identities = 201/399 (50%), Positives = 264/399 (66%), Gaps = 9/399 (2%)

Query: 1   MSREVYICDAVRTPIGRFGGSLAAVRADDLAAVPVKALVERNPQVDWSQLDEVYLGCANQ 60
           + +++ I D  RT IG FGGSLA      L A   KA +ER+  V+ +Q+  V  G    
Sbjct: 3   LDQDIVILDGARTAIGTFGGSLAGTAPITLGATVAKAALERSG-VEGAQIGHVVFGHVIN 61

Query: 61  AGEDNRNVARMALLLAGLPDSVPGVTLNRLCASGMDAVGTAFRAIASGEAELVIAGGVES 120
               +  ++R+A + AG+PD+ P + +NRLC SG  A+ +  +++  G+A+  +AGG ES
Sbjct: 62  TEPRDMYLSRVAAMEAGIPDTTPAMNVNRLCGSGAQALVSVIQSLMLGDAQFGLAGGAES 121

Query: 121 MSRAPYVMGKADSAFGRGQKIEDTTIGWRFINPLMKAQYGVDAMPETADNVADDYKVSRA 180
           MSR+PY M  A      GQK+ D T     +  L    +G   M  TA+NVA ++ + RA
Sbjct: 122 MSRSPYAMPVARW----GQKMGDATAMDMMLGAL-NCPFGTGHMGVTAENVAAEHGIGRA 176

Query: 181 DQDAFALRSQQLAGRAQAAGYFAEEIVPVVIKGKKGETVVDADEHLRPDTTLEALAKLKP 240
           DQDAFAL SQ  A RAQ AG+F  +IVPV +K K+       DEH +P TT EALA L+ 
Sbjct: 177 DQDAFALESQARAARAQEAGHFNSQIVPVPVKVKRDMVDFVRDEHPKP-TTAEALAGLRT 235

Query: 241 VNGPDKTVTAGNASGVNDGSVALILASAEAVKKHGLKARAKVLGMASAGVAPRVMGIGPV 300
           V   D TVTAGNASG+NDG+ AL+LA A A +  GLK RA++LG A AGV P VMGIGPV
Sbjct: 236 VFQKDGTVTAGNASGINDGAAALVLARASAAESAGLKPRARILGYAHAGVRPEVMGIGPV 295

Query: 301 PAVRKLLERLNLSVADFDVIELNEAFAAQGLAVTRELGIADDDARVNPNGGAIALGHPLG 360
           PAV+ LL + +LSV+DFDVIE NEAFAAQ LAV + LG+  D A+VNPNGGAIALGHP+G
Sbjct: 296 PAVQALLAKTDLSVSDFDVIESNEAFAAQALAVNKGLGL--DPAKVNPNGGAIALGHPVG 353

Query: 361 ASGARLVLTAVHQLEKSGGQRGLCTMCVGVGQGVALAVE 399
           A+GA + L A+++LE+ GG+R L TMC+G GQG+ALA E
Sbjct: 354 ATGAIIALKALYELERIGGKRALVTMCIGGGQGIALAFE 392


Lambda     K      H
   0.317    0.134    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 448
Number of extensions: 24
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 394
Length adjustment: 31
Effective length of query: 370
Effective length of database: 363
Effective search space:   134310
Effective search space used:   134310
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory