Align protocatechuate 3,4-dioxygenase (subunit 1/2) (EC 1.13.11.3) (characterized)
to candidate 3610096 Dshi_3477 protocatechuate 3,4-dioxygenase, beta subunit (RefSeq)
Query= BRENDA::A0A193DXP2 (246 letters) >FitnessBrowser__Dino:3610096 Length = 245 Score = 325 bits (832), Expect = 7e-94 Identities = 153/240 (63%), Positives = 179/240 (74%) Query: 6 PETGPFFARNRDIHPLAYAPGYKTSILRSPQRALISLEGTKSEITGPVFGHGMLNPLDND 65 P+ G +F R+R HP A +P YKT++ R+P A +S + E TGPVFGH L PLD D Sbjct: 5 PKPGGYFPRDRGWHPPALSPAYKTTVKRAPSLAPLSFPTSLGEETGPVFGHETLGPLDGD 64 Query: 66 LILNYARPGEMPVGPRILVHGRVLDERGRGVDGALVEFWQANAGGRYRHKKESYLAAIDP 125 LI N+A +GPRI+VHGRVLDER R V GAL+E WQANAGGRYRH+ ESYLA +DP Sbjct: 65 LIHNFAGLENPAIGPRIVVHGRVLDERARPVPGALIEIWQANAGGRYRHRNESYLAPLDP 124 Query: 126 NFGGVGRTITDENGYYWFKTIQPGAYPWPNGVNDWRPAHIHFSIFGHGFAQRLITQMYFE 185 +FGG GR I+ E+G Y F+T+ PG YPWPNG+NDWRPAHIH SIFG FAQRL+TQMYFE Sbjct: 125 HFGGCGRVISREDGSYEFRTVMPGPYPWPNGMNDWRPAHIHLSIFGPAFAQRLVTQMYFE 184 Query: 186 GDPLIWKCPIVKTIPDEDAIRRLIAPLDMNATLPMDMLAYKFDIVLRGRRSTLFENRMEG 245 GDPLIW CPIV IP AI LIAP+D +PMD AYKFDIVLRGRR T+FENR +G Sbjct: 185 GDPLIWLCPIVGAIPSRAAIESLIAPVDSARNIPMDARAYKFDIVLRGRRQTMFENRKDG 244 Lambda K H 0.322 0.142 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 246 Length of database: 245 Length adjustment: 24 Effective length of query: 222 Effective length of database: 221 Effective search space: 49062 Effective search space used: 49062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory