Align D-lactate transporter, ATP-binding component (characterized)
to candidate 3610346 Dshi_3727 ABC transporter related (RefSeq)
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__Dino:3610346 Length = 246 Score = 172 bits (437), Expect = 4e-48 Identities = 87/246 (35%), Positives = 141/246 (57%), Gaps = 5/246 (2%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 IL+ +G FGGL+A+ ++ N + +IGPNGAGK+TL N + G L P +GSV Sbjct: 4 ILQTDRLGISFGGLRAVDAISFDALPNQITTVIGPNGAGKTTLFNLISGALKPGSGSVNL 63 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSGQ 122 DG+ V P E+ + G++R FQ +F D++V EN+ + + M + Sbjct: 64 DGRDVTRAGPAELQRAGLARSFQITNLFFDMTVRENLRLATQVLEPASHLMRPLRRTGRA 123 Query: 123 RDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMARA 182 + K + ++ + DK H +S G++RRLEI MCL+ EP++L+LDEPT GM+ A Sbjct: 124 AN---KVDELIARFELHDKVHEQVGYLSHGEQRRLEIAMCLACEPKVLMLDEPTQGMSHA 180 Query: 183 DTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPKV 242 DT T L++ + ++I +IEHD+ +V +++D + V+ QG + + P ++ NP V Sbjct: 181 DTEETEALIRGLTDH--VSILLIEHDIGIVMAVSDHVIVMHQGQKIADGTPTEVRANPAV 238 Query: 243 REAYLG 248 + AY G Sbjct: 239 QAAYFG 244 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 246 Length adjustment: 24 Effective length of query: 227 Effective length of database: 222 Effective search space: 50394 Effective search space used: 50394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory