Align L-lactate dehydrogenase; EC 1.1.1.27 (uncharacterized)
to candidate 3608646 Dshi_2039 Malate/L-lactate dehydrogenase (RefSeq)
Query= curated2:Q07251 (349 letters) >FitnessBrowser__Dino:3608646 Length = 339 Score = 131 bits (329), Expect = 3e-35 Identities = 86/268 (32%), Positives = 123/268 (45%), Gaps = 14/268 (5%) Query: 3 ISLTSARQLARDILAAQQVPADIADDVAEHLVESDRCGYISHGLSILPNYRTALDGHSVN 62 +SL AR L A VP A A+ LV ++ G + HG S L +Y + Sbjct: 9 LSLPDARDLLFRAFTANGVPEGAARSTADALVAAEAEGQVGHGFSRLEDYVAQARSGKIV 68 Query: 63 PQGRAKCVLDQGTLMVFDGDGGFGQHVGKSVMQAAIERVRQHGHCIVTLRRSHHLGRMGH 122 T ++ D GF + + I R+ G + + RSHH G + Sbjct: 69 AGAEVTITRPAPTTLLVDAGHGFAYPALERAIDEGIAVARELGTAAIAVTRSHHCGALSI 128 Query: 123 YGEMAAAAGFVLLSFTNVINRAPVVAPFGGRVARLTTNPLCFAGPMPNGRPPLVVDIATS 182 + E AA AG V + V+N +AP+GG+ TNP+ FA P G PLV+D++ S Sbjct: 129 HVERAAKAGLVAMM---VVNAPAAIAPWGGKTPLFGTNPIAFATPRA-GSAPLVIDLSLS 184 Query: 183 AIAINKARVLAEKGEPAPEGSIIGADGNPTTDASTMFGEHPGALLPFGGHKGYALGVVAE 242 +A K + G+P PEG + A GNPTTDA G G ++P G KG AL ++ E Sbjct: 185 KVARGKVMNAKKAGKPIPEGWALDAAGNPTTDAEAALG---GTMVPIGEAKGTALALMVE 241 Query: 243 LLAGVLSG-------GGTIQPDNPRGGV 263 +L+ V++G G D P GV Sbjct: 242 ILSAVMTGAALSTEAGSFFSADGPPPGV 269 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 349 Length of database: 339 Length adjustment: 29 Effective length of query: 320 Effective length of database: 310 Effective search space: 99200 Effective search space used: 99200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory