Align L-lactate dehydrogenase; EC 1.1.1.27 (uncharacterized)
to candidate 3609158 Dshi_2546 Malate/L-lactate dehydrogenase (RefSeq)
Query= curated2:Q07251 (349 letters) >FitnessBrowser__Dino:3609158 Length = 351 Score = 162 bits (409), Expect = 2e-44 Identities = 120/352 (34%), Positives = 172/352 (48%), Gaps = 21/352 (5%) Query: 3 ISLTSARQLARDILAAQQVPADIADDVAEHLVESDRCGYISHGLSILPNYRTALDGHSVN 62 IS + + L+A+ VP A+ VA +VE+D GY +HG+ L Y L+G N Sbjct: 6 ISAEALQDFVARALSARGVPTQDANKVAGLMVEADIYGYGTHGVFRLRQYLARLEGGGCN 65 Query: 63 PQGRAKCVLDQGTLMVFDGDGGFGQHVGKSVMQAAIERVRQHGHCIVTLRRSHHLGRMGH 122 P + + DGD GFG + A+E+ RQ G V +RR +H G + Sbjct: 66 PAPNISVLQQTVATALIDGDNGFGHLAMAAARDLAMEKARQAGIGWVGVRRGNHAGPLAL 125 Query: 123 YGEMAAAAGFVLLSFTNVINRAPVVAPFGGRVARLTTNPLCFAGPMPNGRPPLVVDIATS 182 Y A AG LL + A V P+GG L TNP+ F+ P G P V D+AT+ Sbjct: 126 YVRPQAEAG--LLGMAAAVGSANHVPPYGGTDLLLGTNPIAFSAP-AEGPDPFVFDMATT 182 Query: 183 AIAINKARVLAEKGEPAPEGSIIGADGNPTTDASTMFGEHPGALLPFGGHKGYALGVVAE 242 A+ K + L ++G PEG ++G DG P TD + + G LLP GG KG+ L V Sbjct: 183 VAAMGKIKTLLQQGADMPEGWMVGRDGKPLTDPAR---KSEGFLLPIGGPKGFGLSVAIG 239 Query: 243 LLAGVLSGG--GTIQPDNPRGGVATNNL--FAVLLNPALDLGLDWQSAEVEAFV-RYLHD 297 L+AGVL+G G+ D + N F + L+PA GL AE V + Sbjct: 240 LMAGVLNGAAFGSDVVDFTSDTTSPTNTGQFVMALDPAA-FGLGDGFAETARRVFGEMRA 298 Query: 298 TPPAPGVDRVQYPGEYEAANRAQASDT-----LNINPAIWRNLERLAQSLNV 344 +PP PG V+ PG+ + QA++T L +NPA+ ++L+ LA+ V Sbjct: 299 SPPLPGHHPVRLPGD----GKTQAAETRRRQGLTLNPALRKDLDALAEKYGV 346 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 349 Length of database: 351 Length adjustment: 29 Effective length of query: 320 Effective length of database: 322 Effective search space: 103040 Effective search space used: 103040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory