Align dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), small permease component (characterized)
to candidate 3608436 Dshi_1833 Tripartite ATP-independent periplasmic transporter DctQ component (RefSeq)
Query= reanno::PV4:5208944 (212 letters) >FitnessBrowser__Dino:3608436 Length = 188 Score = 64.3 bits (155), Expect = 1e-15 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 3/110 (2%) Query: 2 MSRFF---SHIEEVVLNALITAMTLLVFVEVIARFFFNTGFLWIQELTLTICGWFVLFGM 58 M++F+ +IE + L+ L+F++VI R F+ F W++EL++ + WFV FG Sbjct: 1 MTKFWHIVDNIESYICRTLLAIFVCLLFLQVIVRTLFDFSFSWVEELSIYMFVWFVFFGA 60 Query: 59 SYGVKVGAHIGVDAFVKKLPAQGRKYTAILAVAICLIYCGMFLVGSWDYL 108 SY K+GAH V K LP + KY A + + F+ + D++ Sbjct: 61 SYAAKMGAHNRVTFQFKFLPPRKIKYIEAFADLFWIFFNVYFVYLAIDFI 110 Lambda K H 0.329 0.144 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 188 Length adjustment: 21 Effective length of query: 191 Effective length of database: 167 Effective search space: 31897 Effective search space used: 31897 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory