GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Dinoroseobacter shibae DFL-12

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate 3607991 Dshi_1399 acetate--CoA ligase (RefSeq)

Query= SwissProt::P27550
         (652 letters)



>lcl|FitnessBrowser__Dino:3607991 Dshi_1399 acetate--CoA ligase
           (RefSeq)
          Length = 653

 Score =  842 bits (2176), Expect = 0.0
 Identities = 401/642 (62%), Positives = 494/642 (76%), Gaps = 5/642 (0%)

Query: 7   HTIPANIADRCLINPQQYEAMYQQSINVPDTFWGEQGKILDWIKPYQKVKNTSFAPGNVS 66
           +T  A+      I+  +Y  MY  S++ P+ FWGE G+ LDWIKPY KVK+TSFA  +V 
Sbjct: 9   YTPSADFVKNAHIDSSKYSEMYAASVSDPEGFWGEHGRSLDWIKPYTKVKDTSFAHDDVH 68

Query: 67  IKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDD-ASQSKHISYKELHRDVCRFANTLL 125
           ++W+EDGTLN+AANC+DRHL   GD+TAII+E DD A  ++HI+Y+ELHR VC+ +N L 
Sbjct: 69  VRWFEDGTLNVAANCIDRHLATRGDQTAIIFEPDDPAEPAQHITYRELHRQVCKLSNVLE 128

Query: 126 ELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVIT 185
           +LG++KGD V +YMPM+PEAA AMLACARIGA+HS++F GFSP+A++ RI  +++RL+IT
Sbjct: 129 DLGVRKGDRVILYMPMIPEAAYAMLACARIGAIHSIVFAGFSPDALSARINGADARLLIT 188

Query: 186 SDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDLVEQAS 245
           +D   R GR  PLK N D AL +        ++V+KRTGG+  W +GRD  +H+L+ +A 
Sbjct: 189 ADYAPRGGRQTPLKSNADAALLHTR--DDVKMLVVKRTGGQTTWVDGRDFDYHELMLEAD 246

Query: 246 DQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDIYWCTA 305
           +     E+ AE PLFILYTSGSTG+PKGV+H++GGYL+YAA+T KYVFD H GD+YWCTA
Sbjct: 247 EVQHPVEVEAEHPLFILYTSGSTGQPKGVVHSSGGYLLYAAMTQKYVFDVHEGDVYWCTA 306

Query: 306 DVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALM 365
           DVGWVTGHSY++YGPLA G TT+MFEGVP +P  +R  QV DKH+V   YTAPTAIRALM
Sbjct: 307 DVGWVTGHSYIVYGPLANGGTTVMFEGVPTYPDASRFWQVCDKHKVTQFYTAPTAIRALM 366

Query: 366 AEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITP 425
           A+G + +E  D SSLR+LG+VGEPINPEAW WY   +G  +CP+VDTWWQTETGG ++TP
Sbjct: 367 AKGPEFVETCDLSSLRVLGTVGEPINPEAWNWYNDLVGKGRCPIVDTWWQTETGGHLLTP 426

Query: 426 LPGATELKAGSATRPFFGVQPALVDNEGNP--LEGATEGSLVITDSWPGQARTLFGDHER 483
           LPGA   K GSAT PFFGVQP ++D        E   EG L + DSWPGQ RT++GDHER
Sbjct: 427 LPGAIATKPGSATLPFFGVQPVVLDPHSGAEITETECEGVLCLKDSWPGQMRTVYGDHER 486

Query: 484 FEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIA 543
           F +TYFS +K  YFSGDG RRD DGYYWITGRVDDV+NVSGHR+GTAE+ESALVAH K+A
Sbjct: 487 FVKTYFSDYKGYYFSGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALVAHAKVA 546

Query: 544 EAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLP 603
           EAAVVG PH+IKGQ IY YVTL +GEEPS EL  E+R WVR EIGP+A PD++ W   LP
Sbjct: 547 EAAVVGYPHDIKGQGIYCYVTLMNGEEPSEELRKELRTWVRTEIGPIAAPDLIQWAPGLP 606

Query: 604 KTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEK 645
           KTRSGKIMRRILRKIA  D   LGDTSTLADP VVE L+E +
Sbjct: 607 KTRSGKIMRRILRKIAEDDFGALGDTSTLADPSVVEDLIENR 648


Lambda     K      H
   0.317    0.135    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1427
Number of extensions: 66
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 652
Length of database: 653
Length adjustment: 38
Effective length of query: 614
Effective length of database: 615
Effective search space:   377610
Effective search space used:   377610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

Align candidate 3607991 Dshi_1399 (acetate--CoA ligase (RefSeq))
to HMM TIGR02188 (acs: acetate--CoA ligase (EC 6.2.1.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02188.hmm
# target sequence database:        /tmp/gapView.4518.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02188  [M=629]
Accession:   TIGR02188
Description: Ac_CoA_lig_AcsA: acetate--CoA ligase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
          0 1010.8   0.0          0 1010.5   0.0    1.0  1  lcl|FitnessBrowser__Dino:3607991  Dshi_1399 acetate--CoA ligase (R


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dino:3607991  Dshi_1399 acetate--CoA ligase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1010.5   0.0         0         0       4     628 ..      23     646 ..      20     647 .. 0.98

  Alignments for each domain:
  == domain 1  score: 1010.5 bits;  conditional E-value: 0
                         TIGR02188   4 leeykelyeeaiedpekfwaklakeelewlkpfekvldeslep...kvkWfedgelnvsyncvdrhvekrkdkvaii 77 
                                        ++y+e+y+ +++dpe fw+++++ +l+w+kp++kv+d+s+++   +v+Wfedg+lnv++nc+drh+++r d++aii
  lcl|FitnessBrowser__Dino:3607991  23 SSKYSEMYAASVSDPEGFWGEHGR-SLDWIKPYTKVKDTSFAHddvHVRWFEDGTLNVAANCIDRHLATRGDQTAII 98 
                                       679*********************.6**************99888899***************************** PP

                         TIGR02188  78 wegdeegedsrkltYaellrevcrlanvlkelGvkkgdrvaiYlpmipeaviamlacaRiGavhsvvfaGfsaeala 154
                                       +e d++ e ++++tY+el+r+vc+l+nvl++lGv+kgdrv++Y+pmipea++amlacaRiGa+hs+vfaGfs++al 
  lcl|FitnessBrowser__Dino:3607991  99 FEPDDPAEPAQHITYRELHRQVCKLSNVLEDLGVRKGDRVILYMPMIPEAAYAMLACARIGAIHSIVFAGFSPDALS 175
                                       ***************************************************************************** PP

                         TIGR02188 155 eRivdaeaklvitadeglRggkvielkkivdealekaeesvekvlvvkrtgeevaewkegrDvwweelvekeasaec 231
                                        Ri+ a+a+l+itad + Rgg++++lk+++d+al ++ ++v+ +lvvkrtg + ++w++grD+ ++el+ + a++  
  lcl|FitnessBrowser__Dino:3607991 176 ARINGADARLLITADYAPRGGRQTPLKSNADAALLHTRDDVK-MLVVKRTGGQ-TTWVDGRDFDYHELMLE-ADEVQ 249
                                       *************************************99997.899*******.56**************6.99999 PP

                         TIGR02188 232 epekldsedplfiLYtsGstGkPkGvlhttgGylllaaltvkyvfdikdedifwCtaDvGWvtGhsYivygPLanGa 308
                                       +p ++++e+plfiLYtsGstG+PkGv+h++gGyll+aa+t+kyvfd++++d++wCtaDvGWvtGhsYivygPLanG 
  lcl|FitnessBrowser__Dino:3607991 250 HPVEVEAEHPLFILYTSGSTGQPKGVVHSSGGYLLYAAMTQKYVFDVHEGDVYWCTADVGWVTGHSYIVYGPLANGG 326
                                       999************************************************************************** PP

                         TIGR02188 309 ttllfegvptypdasrfweviekykvtifYtaPtaiRalmklgeelvkkhdlsslrvlgsvGepinpeaweWyyevv 385
                                       tt++fegvptypdasrfw+v++k+kvt+fYtaPtaiRalm++g e+v+  dlsslrvlg+vGepinpeaw+Wy++ v
  lcl|FitnessBrowser__Dino:3607991 327 TTVMFEGVPTYPDASRFWQVCDKHKVTQFYTAPTAIRALMAKGPEFVETCDLSSLRVLGTVGEPINPEAWNWYNDLV 403
                                       ***************************************************************************** PP

                         TIGR02188 386 GkekcpivdtwWqtetGgilitplpgvatelkpgsatlPlfGieaevvd.eegkeveeeeeggvLvikkpwPsmlrt 461
                                       Gk++cpivdtwWqtetGg+l+tplpg a+++kpgsatlP+fG++++v+d ++g e++e+e +gvL++k++wP+++rt
  lcl|FitnessBrowser__Dino:3607991 404 GKGRCPIVDTWWQTETGGHLLTPLPG-AIATKPGSATLPFFGVQPVVLDpHSGAEITETECEGVLCLKDSWPGQMRT 479
                                       **************************.6*********************999*****99999*************** PP

                         TIGR02188 462 iygdeerfvetYfkklkglyftGDgarrdkdGyiwilGRvDdvinvsGhrlgtaeiesalvsheavaeaavvgvpde 538
                                       +ygd+erfv+tYf+++kg+yf+GDg+rrd+dGy+wi+GRvDdvinvsGhr+gtae+esalv+h +vaeaavvg+p++
  lcl|FitnessBrowser__Dino:3607991 480 VYGDHERFVKTYFSDYKGYYFSGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALVAHAKVAEAAVVGYPHD 556
                                       ***************************************************************************** PP

                         TIGR02188 539 ikgeaivafvvlkegveedeeelekelkklvrkeigpiakpdkilvveelPktRsGkimRRllrkiaege.ellgdv 614
                                       ikg+ i+++v+l++g+e++ee l+kel+++vr+eigpia+pd i++++ lPktRsGkimRR+lrkiae++  +lgd+
  lcl|FitnessBrowser__Dino:3607991 557 IKGQGIYCYVTLMNGEEPSEE-LRKELRTWVRTEIGPIAAPDLIQWAPGLPKTRSGKIMRRILRKIAEDDfGALGDT 632
                                       ********************5.******************************************************* PP

                         TIGR02188 615 stledpsvveelke 628
                                       stl+dpsvve+l+e
  lcl|FitnessBrowser__Dino:3607991 633 STLADPSVVEDLIE 646
                                       **********9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (629 nodes)
Target sequences:                          1  (653 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.02s 00:00:00.06 Elapsed: 00:00:00.05
# Mc/sec: 7.44
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory