Align Inner-membrane translocator (characterized, see rationale)
to candidate 3607106 Dshi_0528 Monosaccharide-transporting ATPase (RefSeq)
Query= uniprot:A0KWY6 (405 letters) >FitnessBrowser__Dino:3607106 Length = 334 Score = 112 bits (280), Expect = 2e-29 Identities = 83/270 (30%), Positives = 136/270 (50%), Gaps = 11/270 (4%) Query: 108 ALLSIGMSLVIATGGIDLSVGAVMAIAGAVCANLLL----------VPDISLVTVIAAGL 157 A+L++ M++ + TGGIDLSV + ++ V A +L I L I A L Sbjct: 52 AILALAMTIAMMTGGIDLSVVGIANLSAVVAALILTHFSNAEMPAAQSAIWLAIAITAAL 111 Query: 158 IVGLLAGCINGGLVSFLGIQPIVATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVGQF 217 +G +AG ING LV+F G+ PI+ATL + G A + G + A IG Sbjct: 112 CIGAIAGLINGSLVAFFGLPPILATLGSGLVFTGFAIAMTGGSAVMGFPDTVALIGNATL 171 Query: 218 LGLPMPVWIVIGMLTFSQLLLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGL 277 G+P+P+ + + L+L +TA GL + G N A+ Y I+ + L Y IAG+ Sbjct: 172 AGVPVPLILFAVLAFLLHLVLTRTAFGLRVTMYGANPLAALYAAIDINRMLLKVYVIAGM 231 Query: 278 CAALAGMISTADIQGSDANNAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTL 337 A++AG+I + + A+ +L L AVL V+GG GG +I V+ L +Q L Sbjct: 232 FASVAGLIIMSRANSAKADYGSSYLLL-AVLIAVLGGVNPYGGYGRVIGVVLAVLSMQFL 290 Query: 338 ATTIIVSGLPAKFNLLIKAIVILTVLLLQS 367 ++ + + G+ LI +++ V+++ + Sbjct: 291 SSGLNMLGVSNFARELIWGALLILVMVINT 320 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 334 Length adjustment: 30 Effective length of query: 375 Effective length of database: 304 Effective search space: 114000 Effective search space used: 114000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory