GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gguA in Dinoroseobacter shibae DFL-12

Align GguA aka ATU2347 aka AGR_C_4264, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate 3609044 Dshi_2433 ABC transporter related (RefSeq)

Query= TCDB::O05176
         (512 letters)



>lcl|FitnessBrowser__Dino:3609044 Dshi_2433 ABC transporter related
           (RefSeq)
          Length = 510

 Score =  371 bits (953), Expect = e-107
 Identities = 205/504 (40%), Positives = 315/504 (62%), Gaps = 16/504 (3%)

Query: 1   MANTILEMRNITKTFPGVKALENVNLKVKEGEIHALVGENGAGKSTLMKVLSGVY-PAGT 59
           ++   L + +ITKTFPGVKAL +V+L +  G++ AL+GENGAGKST++K+L+G+Y P G 
Sbjct: 16  VSQAALALAHITKTFPGVKALSDVSLSLYPGKVTALIGENGAGKSTVVKILTGIYQPDG- 74

Query: 60  YEGEIHYEGAVRNFRAINDSEDIGIIIIHQELALVPLLSIAENIFLGNEV-ASNGVISWQ 118
             G I  +G    F     + D G+  IHQE  L   LS+AENIFLG+    + G+I W+
Sbjct: 75  --GRILVDGQPVPFSTPQAAADHGVTAIHQETVLFDELSVAENIFLGHAPRGAFGLIDWK 132

Query: 119 QTFNRTRELLKKVGLKESPETLITDIGVGKQQLVEIAKALSKSVKLLILDEPTASLNESD 178
           +T    R LL  +G +  P+  + D+G+  + LV IA+ALS   +++I+DEPTA+L+  +
Sbjct: 133 KTTENARALLTSIGAELDPDHKLKDLGIANKHLVAIARALSIEARVVIMDEPTAALSHKE 192

Query: 179 SEALLNLLMEFRNQGMTSIIITHKLNEVRKVADQITVLRDGMTVKTLDCHQEEISEDVII 238
            E L  L+   + QG   + I+HK +E+ ++AD  TV RDG  +   D    +++E  ++
Sbjct: 193 IEELYELVESLKAQGKAILFISHKFDEIFRIADNYTVFRDGQLIG--DGAIADVTEADLV 250

Query: 239 RNMVGRDLEDRYPPRDVPIGETILEVKNWNAYHQQHRDRQVLHDINVTVRKGEVVGIAGL 298
           + MVGRD+   +P R   +G+T+L V+ +   H    D     DI+ T+R+GE++G  GL
Sbjct: 251 KMMVGRDVSQIFPQRAPNVGDTVLTVQGYA--HPTEFD-----DISFTLREGEILGFYGL 303

Query: 299 MGAGRTEFAMSVFGKSYGHRITGDVLIDGKPVDVSTVRKAIDAGLAYVTEDRKHLGLVLN 358
           +GAGR+EF  S+FG +      G V I G   ++S+   A+D G+ YV EDR   G +L+
Sbjct: 304 VGAGRSEFMQSLFGIT--RPSAGSVEIGGARAEISSPADAVDHGIVYVPEDRGKQGAILD 361

Query: 359 DNILHNTTLANLAGVSKASIIDDIKEMKVASDFRTRLRIRSSGIFQETVNLSGGNQQKVV 418
             I  N TL +L  +S+   +   +E  +A ++  RL +R++ +     NLSGGNQQKVV
Sbjct: 362 LPIFQNVTLPSLGRISRKGFLRLAEEFALAREYTERLDLRAASLDTHVGNLSGGNQQKVV 421

Query: 419 LSKWLFSNPDVLILDEPTRGIDVGAKYEIYTIINQLAADGKGVLMISSEMPELLGNCDRI 478
           ++KWL + P V+ILDEPT+G+D+G+K  ++  + +LAA G  V+M+SSE+PE+LG  DR+
Sbjct: 422 IAKWLATRPRVIILDEPTKGVDIGSKAAVHDFMAELAAQGLAVIMVSSEIPEVLGMSDRV 481

Query: 479 YVMNEGRIVAELPKGEASQESIMR 502
            VM EGRIVAEL   +   E+++R
Sbjct: 482 IVMREGRIVAELAGDDLQPETLVR 505



 Score = 65.5 bits (158), Expect = 4e-15
 Identities = 59/257 (22%), Positives = 115/257 (44%), Gaps = 14/257 (5%)

Query: 251 PPRDVPIGETILEVKNWNAYHQQHRDRQVLHDINVTVRKGEVVGIAGLMGAGRTEFAMSV 310
           P  D P+ +  L + +     +     + L D+++++  G+V  + G  GAG++     +
Sbjct: 10  PSEDPPVSQAALALAHIT---KTFPGVKALSDVSLSLYPGKVTALIGENGAGKSTVVKIL 66

Query: 311 FGKSYGHRITGDVLIDGKPVDVSTVRKAIDAGLAYVTEDRKHLGLVLND--NILHNTTLA 368
            G        G +L+DG+PV  ST + A D G+  +     H   VL D  ++  N  L 
Sbjct: 67  TGIYQPDG--GRILVDGQPVPFSTPQAAADHGVTAI-----HQETVLFDELSVAENIFLG 119

Query: 369 NLAGVSKASIIDDIKEMKVASDFRTRLRIRSSGIFQETVNLSGGNQQKVVLSKWLFSNPD 428
           + A      +ID  K  + A    T +         +  +L   N+  V +++ L     
Sbjct: 120 H-APRGAFGLIDWKKTTENARALLTSIGAELDPD-HKLKDLGIANKHLVAIARALSIEAR 177

Query: 429 VLILDEPTRGIDVGAKYEIYTIINQLAADGKGVLMISSEMPELLGNCDRIYVMNEGRIVA 488
           V+I+DEPT  +      E+Y ++  L A GK +L IS +  E+    D   V  +G+++ 
Sbjct: 178 VVIMDEPTAALSHKEIEELYELVESLKAQGKAILFISHKFDEIFRIADNYTVFRDGQLIG 237

Query: 489 ELPKGEASQESIMRAIM 505
           +    + ++  +++ ++
Sbjct: 238 DGAIADVTEADLVKMMV 254


Lambda     K      H
   0.316    0.135    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 599
Number of extensions: 28
Number of successful extensions: 11
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 512
Length of database: 510
Length adjustment: 35
Effective length of query: 477
Effective length of database: 475
Effective search space:   226575
Effective search space used:   226575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory