GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gguB in Dinoroseobacter shibae DFL-12

Align GguB aka ATU2346 aka AGR_C_4262, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate 3608606 Dshi_1999 inner-membrane translocator (RefSeq)

Query= TCDB::O05177
         (398 letters)



>lcl|FitnessBrowser__Dino:3608606 Dshi_1999 inner-membrane
           translocator (RefSeq)
          Length = 435

 Score =  215 bits (548), Expect = 2e-60
 Identities = 145/440 (32%), Positives = 225/440 (51%), Gaps = 50/440 (11%)

Query: 1   MSSANTTNEESNVISVGSYIRS---NIREYGMLIALVAIMVFFQFYTGGILFRPVNLTNL 57
           MS A+ T       +  S++++   + R  GM+ A V + + F   T G      N+ NL
Sbjct: 1   MSDASPTESRLPSRAKRSFLQTLELDTRLLGMIGAFVLVCLVFNLLTDGRFLTARNIFNL 60

Query: 58  ILQNSFIVIMALGMLLVIVAGHIDLSVGSIVAFVGAI-----AAILTVQWGMN------P 106
            +Q   + IMA GM+ +IV  HIDL+VG+++A   A       AIL   +G+       P
Sbjct: 61  SIQTVSVAIMATGMVFIIVTRHIDLAVGALLATCSAAMAMTQTAILPQVFGLELGHPAIP 120

Query: 107 FLAALICLVIGGIIGAAQGYWIAYHRIPSFIVTLAGMLVFRGLTLFVLGGKNIGPFPTDF 166
           ++A L+ LV G +IGA QGY + Y  IP+FIVTL G+LV+R +  ++  G+ IGP    F
Sbjct: 121 WIAMLVGLVTGTVIGAFQGYLVGYLMIPAFIVTLGGLLVWRNVAWYMTNGQTIGPLDPTF 180

Query: 167 QVISTGFLPDIGGIEGL--NTTSMILTVLITVALFYLAWRRRVVNVKHGIDVEPFGFFIV 224
             +        GGI G    T S I+ ++  VA  +  W  R   + H   V+P    + 
Sbjct: 181 MTL--------GGINGTLGATLSWIVGLVAVVAACWALWSGRKNKIAHDAPVKPVWAELT 232

Query: 225 QNLLISGAILFL-----GYQLSTYR--------------------GLPNVLIVMLVLIAL 259
              ++S AIL        Y++ T R                    G+P  +++++ +   
Sbjct: 233 VMGVVSVAILGFVAILNSYEVPTARLRRLFEARGEVMPEGYTEVYGIPYSVLLLIAVAVA 292

Query: 260 YSFVTRRTTIGRRVYAMGGNEKATKLSGINTERLSFLTFVNMGVLAGLAGMIIATRLNSA 319
            + + ++T  GR ++A GGN  A +LSGINT  L+   F  MG L  ++ ++ + RL + 
Sbjct: 293 MTVIAKKTRFGRYIFATGGNPDAAELSGINTRMLTVKVFALMGALCAISAIVASARLTNH 352

Query: 320 TPKAGVGFELDVIAACFIGGASASGGVGKITGAVIGAFIMGVMNNGMSIVGLGIDFQQMV 379
           +   G   EL VIAA  IGG + +GG+G I GA++GA IM  + +GM++VG+    Q +V
Sbjct: 353 SNDIGTLDELRVIAAAVIGGTALAGGIGTIYGAILGALIMQSLQSGMAMVGVDAPLQNIV 412

Query: 380 KGLVLLAAVFFDV-YNKNKG 398
            G VL+AAV  D+ Y K  G
Sbjct: 413 VGTVLVAAVLIDILYRKRMG 432


Lambda     K      H
   0.329    0.145    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 536
Number of extensions: 26
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 398
Length of database: 435
Length adjustment: 31
Effective length of query: 367
Effective length of database: 404
Effective search space:   148268
Effective search space used:   148268
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory