Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate 3607835 Dshi_1243 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= reanno::ANA3:7024897 (256 letters) >FitnessBrowser__Dino:3607835 Length = 258 Score = 218 bits (556), Expect = 8e-62 Identities = 115/249 (46%), Positives = 156/249 (62%), Gaps = 5/249 (2%) Query: 7 YPSLQGKTIFISGGATGIGACLVNAFLEQGAKVAFVDILVEESTQLVADLKQTQPEASVT 66 + L G ++F++GG +GIGA L + FL QGA+VAF+ +++ VA ++ A + Sbjct: 9 FHDLDGASVFVTGGGSGIGAALTDGFLAQGAQVAFIGR--SDASAFVAKMRAAHGRAPL- 65 Query: 67 FYHCDLVDIAALKRVIAQVEDDLGPISVLINNAACDQRHSIDEVTPEYWDQCLNTNLRHY 126 F D+ D AL+ IAQ GPI+ L+NNAA D+RHS EVTPE+WDQ NL+ Y Sbjct: 66 FVQGDITDTDALRAAIAQATAAHGPITALVNNAANDKRHSTAEVTPEFWDQMQAINLKAY 125 Query: 127 FFAVQAVRPQMQRLGGGSVINLGSMSWHNRQAGMAGYTASKAGAMGLTRGLAADLGKDKI 186 FFA QAV P M GGG+++N S+S+ AG YTA+ AG GLTR LA + G D I Sbjct: 126 FFAAQAVTPGMAEAGGGAIVNFSSISYMMGNAGYPAYTAANAGITGLTRSLAREFGPDGI 185 Query: 187 RINTLTPGWVMTKRQLTHW-VDKDTAKHIENNQCIKEYVMPEDIAAMALFLAADDSKLCT 245 R+N L PGWV+T +QL W +D A H++ QC+K ++ PEDI LFLA+ SK+ T Sbjct: 186 RVNALAPGWVLTPKQLEMWATPEDLAAHLD-RQCLKTHLAPEDIVEATLFLASGASKMMT 244 Query: 246 AQNFIVDGG 254 Q +VDGG Sbjct: 245 GQCMVVDGG 253 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 258 Length adjustment: 24 Effective length of query: 232 Effective length of database: 234 Effective search space: 54288 Effective search space used: 54288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory