Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate 3607950 Dshi_1358 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= reanno::pseudo5_N2C3_1:AO356_20240 (272 letters) >FitnessBrowser__Dino:3607950 Length = 258 Score = 140 bits (352), Expect = 4e-38 Identities = 85/250 (34%), Positives = 135/250 (54%), Gaps = 10/250 (4%) Query: 19 LKDKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAQKVEAVAAHWRERGADVHALQAD 78 L+ K L+TGA+ GIG + A ++++ +A ++EAVA R G D Sbjct: 16 LEGKRALITGASSGIGAHLALTLGQAGAEVILAARRADRLEAVAETLRAEGIVAQTAALD 75 Query: 79 VSKQQDLQAMARRAVELHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGCK 138 V+ + A AV G +D+L+N +GV+ ++ TE DW R +L GAW + Sbjct: 76 VTDAASVAA----AVTTVGPLDILINNSGVSGQDMVIDTTEADWDRVLDTNLKGAWRVSR 131 Query: 139 AVLPQMIEQGVGSIINIASVHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNAI 198 A P +I + G+I+N+AS+ ++ PY +K GL+ LTRA+ +E A GVRVNA+ Sbjct: 132 AFAPGLIARQ-GTILNVASILGIGVLKTVGPYAASKAGLIQLTRAMALELARDGVRVNAL 190 Query: 199 APGYIETQLNVDYWNGFADPHAERQRALDLHPPRRVGQPIEVAMTAVFLASDEAPFINAS 258 APGYIET +N +++ A Q+ L P RR+GQP ++ + L A F+ + Sbjct: 191 APGYIETPINTEFFASEAG-----QKMLRGVPQRRLGQPGDLDAAVLMLLGPGAGFVTGA 245 Query: 259 CITIDGGRSV 268 + +DGG ++ Sbjct: 246 TVVVDGGHTL 255 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 258 Length adjustment: 25 Effective length of query: 247 Effective length of database: 233 Effective search space: 57551 Effective search space used: 57551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory