GapMind for catabolism of small carbon sources

 

Aligments for a candidate for artM in Dinoroseobacter shibae DFL-12

Align Histidine transport system permease protein HisM (characterized)
to candidate 3608832 Dshi_2224 polar amino acid ABC transporter, inner membrane subunit (RefSeq)

Query= SwissProt::P0A2I7
         (235 letters)



>lcl|FitnessBrowser__Dino:3608832 Dshi_2224 polar amino acid ABC
           transporter, inner membrane subunit (RefSeq)
          Length = 268

 Score =  126 bits (317), Expect = 4e-34
 Identities = 74/209 (35%), Positives = 115/209 (55%), Gaps = 13/209 (6%)

Query: 33  SVVMGGLLAVILAVGRVSSNKFIRFPIWLFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTD 92
           +++ G  LA  +A+G+ S    +R P   F ++FRG+PL++Q  + Y     L+ V    
Sbjct: 50  ALLFGFFLATAVALGKASDRAVLRVPADWFIFVFRGSPLFIQFFLAYFLFIQLKAVSP-- 107

Query: 93  LLNAF--FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRCI 150
              AF  F S     ++ L LNT AY  EIF GA+RSVP G++EAA AYG + +  +R +
Sbjct: 108 ---AFDPFTSAWAGALVVLFLNTSAYAGEIFYGALRSVPKGDLEAADAYGLAGWTKFRRV 164

Query: 151 ILPSALRIALPAYSNEVILMLHSTALAFTATVP------DLLKIARDINSATYQPFTAFG 204
             P+ LR+A P+Y+NE I + H+T L F A  P      D L  A+     T+ PF  + 
Sbjct: 165 TWPTMLRLAWPSYTNEAIFLFHATTLVFFAGFPAFQQRGDALYYAQYFADKTFNPFIPYP 224

Query: 205 IAAVLYLLISYVLISLFRRAERRWLQHVS 233
           I A  ++L++  +I +F    RR  +H++
Sbjct: 225 IVAFYFILLTLAVIFVFSLINRRLNRHLA 253


Lambda     K      H
   0.330    0.141    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 163
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 235
Length of database: 268
Length adjustment: 24
Effective length of query: 211
Effective length of database: 244
Effective search space:    51484
Effective search space used:    51484
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory